KEGG   Xenopus tropicalis (tropical clawed frog): 779872
Entry
779872            CDS       T01011                                 
Symbol
ckap4
Name
(RefSeq) cytoskeleton-associated protein 4
  KO
K13999  cytoskeleton-associated protein 4
Organism
xtr  Xenopus tropicalis (tropical clawed frog)
Pathway
xtr04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    779872 (ckap4)
SSDB
Motif
Pfam: Crescentin DUF3450 EzrA CENP-F_leu_zip FlgK_D1 SlyX Fib_alpha DUF1664 Fez1 MbeD_MobD FlaC_arch TPR_MLP1_2 Tup_N
Other DBs
NCBI-GeneID: 779872
NCBI-ProteinID: NP_001072418
Xenbase: XB-GENE-5855800
Position
3:16658920..16665917
AA seq 549 aa
MSGGARQRNKGANAESNSQAATHEGEKKFKSNKGVSSSSSQKTSSGLAWKLFTLVFYIGL
IAVCACTGWVVYSLQDELSQIGSNLRHISQQKADLAETVASLQKQAKGLENTVSRLEFIS
KDIQEKQQSHESSLKKSEKDLDQIGAILKKFQREFSGDIQVVKEQRETDSIHFENTVKEK
FMELNNSLNDGIKEVIEVQKTSQEEINMLKDKLASLAEFHLIQSELENLKLSNSELQSSI
LSNGESVQWLMTNAQNLDSITANTNDIQLLRDQHSDLKSNVDAQLAAVEELKAKLSDSSE
LQTLSGKLVQLASTFSDVKSQFEATKNDLLKEFESNTGSLESKLKPIEHTVNVLNSQAAV
QFEDLDDLKASLKEYSQRLGRAEEALEDVQQKSLGDTDAATDKLPNLEEGLKTLNIEVAT
LRSTVADLPKDYTDVEKLQHQITSALEAHKDELDGFRQEYNQWRSSIEENISNIGSSIHQ
LNADELNLSVAKLETDLKMLRIAVDSLVTYSVKIETNQNELESLKDSLQALKESTEMMMV
KLEQIQETV
NT seq 1650 nt   +upstreamnt  +downstreamnt
atgtctgggggtgctaggcagaggaataaaggggcaaatgctgagtctaactcccaagct
gccacacatgaaggggaaaagaagttcaagtccaacaagggggtctcctcttcctcctcc
caaaagacaagttctgggttagcttggaaacttttcacccttgtcttttatataggtctc
attgctgtgtgtgcctgcactggctgggtggtgtacagtctgcaggatgaactgagccaa
atcggcagcaacctccgacacatctcccagcagaaagctgacctggcagagaccgtggcc
tccctgcaaaaacaagctaaaggactggagaacacagtcagccgcctggaattcatttcc
aaagacattcaggaaaagcagcaatcccatgaatcctcccttaaaaaaagtgagaaggat
ttggatcaaatcggggccatactgaaaaaatttcagagagaattctccggcgacattcag
gttgtaaaggagcaaagggagacagactcaatccactttgaaaacactgttaaggagaaa
ttcatggagctcaataattccctgaacgacggcatcaaggaggtcattgaggtgcagaaa
acaagtcaggaggaaatcaacatgttaaaggataaactggcatcgttggctgaattccat
ttgattcagagtgaactcgagaatttaaaactttccaattcagagctgcagtcatcaatc
ttatccaatggagagtctgtccagtggttgatgaccaatgcccaaaatttagattccatt
acagccaacaccaacgacattcaacttctccgagaccaacacagtgacttgaagtcaaat
gtggacgcccaactggcagcggttgaggaattaaaggcaaaattgtcagactctagcgaa
ctccaaacactgagtggaaagctggtgcaactggcttccactttttccgatgtcaaaagt
cagtttgaagccaccaaaaatgacttgctgaaggaatttgaaagcaacactggcagcttg
gaatcaaagttaaaacccattgagcacactgtgaatgtattaaattctcaggcagctgtc
cagtttgaagatttagatgatctaaaagcaagtttaaaggagtatagtcagaggttggga
cgtgccgaggaagctctggaagatgtacagcagaagtctttaggagatacagatgctgca
actgacaagctacccaatttagaggaaggactgaaaacattaaatatagaggttgctact
ttgaggtcaaccgtagctgacctcccgaaagactatactgacgtggagaagctccaacat
cagattactagtgccttagaagctcacaaagatgagcttgatggttttagacaagagtac
aaccagtggagaagtagcattgaagaaaacatcagcaacattggatcttccatccatcag
cttaatgccgatgagttaaacttgtctgtggccaaactggagacagacttgaagatgttg
aggattgcagtcgacagtttggtgacttattcagtcaaaatagaaaccaaccaaaatgag
ttggaatctttgaaggattcacttcaggctctgaaggagagcactgagatgatgatggtg
aaattagaacaaattcaggagacggtataa

DBGET integrated database retrieval system