KEGG   Xenopus tropicalis (western clawed frog): 779929
Entry
779929            CDS       T01011                                 

Gene name
dnaaf2
Definition
(RefSeq) protein kintoun
  KO
K19751  dynein assembly factor 2, axonemal
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:xtr04812]
    779929 (dnaaf2)
Cytoskeleton proteins [BR:xtr04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     Dynein-related proteins
      779929 (dnaaf2)
SSDB
Motif
Pfam: PIH1 PIH1_CS ArlS_N
Other DBs
NCBI-GeneID: 779929
NCBI-ProteinID: NP_001072474
Xenbase: XB-GENE-5887533
UniProt: Q0P4V4
Position
8
AA seq 785 aa
MAAKLQDLELSSEEVDRFSKAFKDPTFREMFIQYAEEISDPENRKKYEQEIYKMENERGM
DIKFIHPKPGYVLLSSVNGVQKCYLNICSNDLIQKPEFKPGKDGEGKAGLHWSLPYSLSP
GRDDLSKDWSKHVIYDVVFHPDTLHIASKNGKFKGIVDSTALEAVASQFNVTLDKANVRT
LSMKYKGVPNPSVLRKPLPEASPKSRDLEDPLCFPYPYDVPTAVGTEKKDQKRVIQKECK
QHLVTPEQDPNVQVAATPNYTVRHRSYVDLQDFRDSRDSTPSPVPKELVITVDLPLLNSA
AGVNLHIAGKNLSLESEKPAYKLNVKLPYAVEDNQGKAQFNKVKKQLIITVPVIQHNILS
LMQDHFQEARGEKDNQNKAEHSVLNKEHTDNSGITSARGTEKLLELEEENQFEGLASISS
MDTGASHLPEILPNLNTFGKEQVVNQMNEDTPNVPTDNLVCPTFTCSQDPTSLTLIVHVR
DIDENSICADVGSNHYHIRCYRKQSRAFYDLLVTFLPHDIIISNEVSVNISEDNVVIGLT
KCPESFGFWKKLYFGVSGQSLQERRFVIEENINKVLACSIPLSQVSPSIQEHQPLIEVLE
MTDEKTHIRLNEPKIEYVDSAEHNEQCTDHSESERDTSLELPNVDGKDSAEQCSSQVSPC
KHNIELGREHTSERDKEPKPTSCTAESTSGQQPNDSHLVCPGDNCAQDSNAENKMACLKS
SVQTTQESDLDEDDMPDNSDHLQNSASSNNILKEISSKDGSVQVISDHTTHCPFQFQNSL
LFELD
NT seq 2358 nt   +upstreamnt  +downstreamnt
atggcggctaaacttcaggatctggagctcagctctgaggaagttgatcgctttagtaag
gcgtttaaggatccgacgttccgagagatgtttattcagtatgcggaggagatcagtgac
cctgagaaccggaaaaagtatgagcaagagatctacaaaatggaaaacgagagaggaatg
gacattaagtttatccacccaaagcccgggtatgtgttgctgagcagtgtcaatggggtg
cagaaatgctaccttaatatctgcagcaatgatctgattcaaaagccagagttcaagcct
ggaaaagacggcgaaggcaaggctgggctgcattggtctctcccatacagtttatcaccg
ggcagggatgatctgagcaaagattggagcaaacacgttatatatgatgtagtgttccat
ccagacactctgcatattgccagcaagaatgggaaattcaaggggatagttgacagcaca
gctttggaagctgttgccagtcagtttaatgtcaccttagacaaagcaaatgtcaggaca
ctcagcatgaaatataagggtgtaccaaatccgtctgtgttgcgaaaaccccttcctgaa
gcctcaccaaaatctagggaccttgaagaccccttatgtttcccttatccatatgatgtt
cctactgcagtaggcacagagaaaaaggaccagaagagagtgatacaaaaagagtgtaaa
caacatttagtgactccagaacaagaccccaacgtacaggttgctgctacccctaactat
actgtgcggcacagatcatacgtggatctgcaggatttccgggattctagagactctaca
ccaagtcctgtacccaaggaattggtaataacggttgatttgcctttgctaaattctgcc
gcaggagtcaaccttcatatagctggcaaaaatttaagcctagagtctgagaaacctgcc
tataaactaaatgtgaaactaccttatgctgtggaagataaccaaggcaaagctcagttc
aacaaagtgaaaaagcagcttatcatcactgtgcccgtgattcagcataatattttgagt
ctaatgcaggatcattttcaagaggctagaggagagaaagataatcaaaataaagctgaa
catagtgttctcaacaaagagcatacagacaatagtggtataacaagtgcacgtgggaca
gaaaaactattagagttagaagaggagaatcaatttgaaggactagcatcaatatctagt
atggatacaggagcttcacatcttccagaaattttaccaaatctaaatacttttggcaaa
gagcaagtagtaaatcagatgaatgaggatacccccaatgtccccactgataaccttgtg
tgtcccacattcacatgttcacaagaccctacctccttgacattaatagtacatgtgaga
gacatagatgagaacagtatctgtgcagatgtgggttccaaccattatcacatcagatgt
tataggaaacaaagtagagctttctatgatttattagtaacatttcttccccatgacata
atcatctcaaatgaggtctcagtgaatatttctgaagacaatgttgttattggactgaca
aaatgtcctgaaagctttggattctggaagaagctgtattttggtgtcagtggccagtca
ttgcaggaaagaaggtttgtcattgaagagaacataaacaaggttctggcatgcagcatt
ccactgtcacaagtttccccatctatccaagagcatcagccactaatagaggtgcttgaa
atgactgatgaaaaaacccacattcgtttaaatgaacccaaaatagaatatgtggacagc
gctgaacataatgagcaatgcactgatcattcagaaagtgagagggataccagcttggaa
ctccctaatgtggatgggaaagacagtgctgaacagtgctcgtctcaagtttccccttgt
aaacataacattgagctgggcagagagcacacttctgaaagggataaggagcccaagccc
acttcctgtactgcagagtctacaagtggccaacagccaaatgattcccatctagtctgc
ccaggagacaactgtgctcaagactccaatgcagaaaacaagatggcctgcttgaaatca
agtgtacaaacaacacaagaaagtgacttggatgaagatgatatgcctgataactcagat
catctgcaaaacagtgcatcttcaaacaatatattaaaagaaatcagcagcaaagatggt
agtgtccaagttatcagtgatcacacaacacattgcccctttcagttccaaaattcattg
ctgtttgaactggactga

DBGET integrated database retrieval system