KEGG   Xenopus tropicalis (western clawed frog): 779988
Entry
779988            CDS       T01011                                 

Symbol
znf180
Name
(RefSeq) zinc finger protein 180
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    779988 (znf180)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xtr03000]
    779988 (znf180)
Transcription factors [BR:xtr03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    779988 (znf180)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_jaz zf_UBZ Zn-ribbon_8 zf-C2H2_6 zinc_ribbon_15 Zn_ribbon_SprT zf-C2HC_2 zf-C2H2_11 zf-C2H2_7
Other DBs
NCBI-GeneID: 779988
NCBI-ProteinID: NP_001072533
Xenbase: XB-GENE-5829966
UniProt: Q0P4L0
Position
3:complement(130713150..130718425)
AA seq 500 aa
MQINHWGAKFQAPVKFEEIAVYFSEEEWGCLAEWQKLLYANVMLDNYETLCYLGFIHEIP
DIITKIWQGRDLYELPLNTSHGSIRIKEELHHPLYLEDLANQQSSIHTQYWQIEGVTCRK
RYCSPEQLPAYPRENRTQVVSLRNKTCSDSRATANQVYGNIGSDQEAWNEGINKKAECMA
GLNSHTTEKYYTCTECGKGFNRSSHLLRHKRIHIGERPYFCGKCGKSFIDSSQLVIHKRT
HTGEKPYACSDCEKSFICKLHLVRHQRSHTGERPYVCSKCGKGFAQSSNLLTHLRTHTGE
KPYSCAQCGKSFIRRSHVIRHQRIHTGEGPYGCTECGKSFTESSALLKHQRTHTGEKPYA
CTQCPKSFMDKSALANHQRTHTGERPYPCRDCGKSFSHSSALVKHQRIHTGEKPYACGKC
EKSFSQTSALVNHQRTHTGEKPFACTDCGKCFTQTSSLVKHQRTHTGERPYTCSECGKSF
TYSSVLVKHQRTHKKEWLGT
NT seq 1503 nt   +upstreamnt  +downstreamnt
atgcagataaaccattggggtgcaaagtttcaggcaccagttaagtttgaagaaatagca
gtgtatttctccgaggaggagtgggggtgtctggcagagtggcagaaactgctttacgcc
aatgtgatgctggacaactacgagaccctgtgctatctgggtttcatccatgagatccca
gacatcataaccaagatttggcagggccgggatctttatgaactgcctttaaatacaagt
catggatccatcaggattaaggaagaactgcaccatcctttgtacctggaagatttggcc
aatcagcagagcagtattcatacacaatactggcagatagagggagtgacctgcaggaaa
cgttactgttcacctgagcaactgcctgcatatccaagagaaaacagaactcaggttgtg
tctttgcgcaataaaacatgcagtgatagtcgtgcaacagccaatcaagtatatgggaat
attggatcagaccaggaggcatggaatgaagggatcaataaaaaggctgaatgcatggct
gggctaaactcccacacaactgagaaatactacacatgtactgaatgtggaaagggcttt
aaccgtagctcccatcttttaaggcacaaaaggatccacataggagagagaccctacttc
tgcggtaaatgcggaaagagtttcattgacagttcccagcttgtcatacataagagaacc
cacacaggggaaaaaccatatgcttgcagtgactgcgagaaaagctttatctgtaagttg
caccttgttaggcaccagcggtcccacactggggagaggccgtacgtctgcagtaaatgt
ggcaaaggctttgcgcagagttcaaatcttttaactcacttgagaactcatacaggggag
aagccatattcctgtgctcagtgtgggaagagctttatccgcaggtcacatgtgatacgg
catcagcgcatacacactggggagggtccttatggctgcactgaatgcggcaagagcttc
acagaaagctcagctcttcttaaacaccagagaacccatacaggggagaaaccatatgcg
tgcactcagtgtccaaagagctttatggacaagtccgccctcgcaaatcaccagagaaca
cacactggggagagaccttatccatgcagggactgtgggaaaagtttctctcacagttca
gcccttgtgaagcatcagagaatccacactggagaaaagccatacgcctgcggcaaatgt
gaaaagagtttctcccagacgtcggctcttgtaaaccatcagagaacccatactggggag
aaaccctttgcttgcacggactgtggcaagtgtttcactcagacttcctctcttgtgaag
catcagagaactcacactggggagagaccgtatacttgcagcgagtgtgggaaaagcttc
acttacagctcagtacttgtcaagcaccagagaacccacaaaaaagagtggttgggtacc
tag

DBGET integrated database retrieval system