KEGG   Xenopus tropicalis (western clawed frog): 780008
Entry
780008            CDS       T01011                                 

Gene name
cep44
Definition
(RefSeq) centrosomal protein of 44 kDa
  KO
K16761  centrosomal protein CEP44
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xtr03036]
    780008 (cep44)
Chromosome and associated proteins [BR:xtr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    780008 (cep44)
SSDB
Motif
Pfam: CEP44 Vir_act_alpha_C
Other DBs
NCBI-GeneID: 780008
NCBI-ProteinID: NP_001072553
Xenbase: XB-GENE-5870163
UniProt: Q0P4I1
Position
1
AA seq 385 aa
MATGDVKGCIRKLEQRLRTLNYPRDVDYSGLIKGDPSAFLPIISYTFTCYSTSIAEILIS
LGIELATKSDLRFIEAVYKVLRDVFNYKPILTKQQFLQCAFSERKIQIICDIVDCVVKKH
KEITGQNKIKNQPVKKIVSAKDQCEVFYPEDMFVQLSVKTEMSTQKKPLVERHTGSEFQL
QTKCYKSALLEEAEEEEPTSDCEEDSHLQREMGSPFETAEETPNSEQVELLRKQLAECQE
KLQRLDCVEERLQSLETSVKGKIIIDETDWNNLLGRVLLLETERLLQSKKSDLPEFARIS
EHRTSSRMANEICSNLKTKADIPESHHQSSGYSSVLSADTSPIAIDINYSSLTEESKETT
KQRMERITKMMEETSELLKFSNNTS
NT seq 1158 nt   +upstreamnt  +downstreamnt
atggcaactggggatgtaaaaggctgtattcgaaagttagaacaaagactaagaacactt
aattaccctagggatgtggactattcaggattgattaaaggagatccttctgcattcttg
cctatcatcagttacacattcacatgctattccacaagcattgcagagattttgatttct
ttgggtatagagctcgcaactaagagcgatttgagatttattgaagcagtctataaggtt
cttagagatgtttttaattataaacctatattaacaaagcagcaatttcttcagtgtgca
ttttctgaacggaaaatacaaataatatgtgacattgttgactgtgttgtgaagaaacac
aaggaaatcaccggtcagaacaagatcaagaaccagccagttaaaaaaattgtttccgct
aaagatcagtgtgaagttttttatccagaagacatgtttgttcaactatcagtgaaaaca
gaaatgtcaacccagaaaaagccactggttgagcgtcatacaggcagtgaatttcagctg
cagactaaatgttataagtcagcacttttggaagaggcagaggaagaagaacctacttca
gattgtgaagaggacagtcatttgcaacgtgaaatgggcagcccatttgaaaccgcggag
gagactcccaattcagagcaggttgaattactaaggaaacagcttgctgaatgtcaagag
aagcttcaacggcttgattgtgtagaagagagactgcaatctttagagacaagtgtgaaa
ggaaaaataattattgatgagacagactggaataacctcctcggccgagtcctccttctg
gaaacagaaagactattgcagtcaaaaaagagtgatttaccagagtttgcccgtattagt
gagcatcgtacatccagcagaatggccaatgagatctgttcaaatttaaagacaaaggca
gatattccagagagtcatcatcagtcgtctggatacagttctgtgttatctgcagacaca
tctcccatagctattgacattaattatagcagcttgacagaagagtcgaaagaaactaca
aagcaaagaatggaaagaataactaaaatgatggaagaaacatcagagcttttaaaattt
tcaaataatacatcatag

DBGET integrated database retrieval system