KEGG   Xenopus tropicalis (western clawed frog): 780089Help
Entry
780089            CDS       T01011                                 

Gene name
bmpr1b, alk-6, alk6, cdw293
Definition
(RefSeq) bone morphogenetic protein receptor type IB
  KO
K13578  bone morphogenetic protein receptor type-1B [EC:2.7.11.30]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04060  Cytokine-cytokine receptor interaction
xtr04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    780089 (bmpr1b)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    780089 (bmpr1b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xtr01001]
    780089 (bmpr1b)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:xtr04090]
    780089 (bmpr1b)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     780089 (bmpr1b)
Protein kinases [BR:xtr01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   780089 (bmpr1b)
CD molecules [BR:xtr04090]
 Proteins
  780089 (bmpr1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase TGF_beta_GS Activin_recp FTA2 Haspin_kinase Protocadherin
Motif
Other DBs
NCBI-GeneID: 780089
NCBI-ProteinID: NP_001072633
Xenbase: XB-GENE-483455
UniProt: Q0IHM5
Position
1
AA seq 532 aa AA seqDB search
MGWMEERNWQLHVSLIMLLSLHTRANLLDNMLLRSSAKLNVDSRKEDTESTAPAPPQKML
ACYCHHHCPEDSFNNTCWTDGYCFTIVEEDESGLPVVTSGCLGLEGSDFQCRDTPIPHQR
RSIECCTDEDFCNRDLHPTLPPLKKPDFVDGSIHYMALLISVTVCSIILAIILIFCYFRY
KRQEARPRYSIGIEQDETYIPPGESLKDLIEQSQSSGSGSGLPLLVQRTIAKQIQMVKQI
GKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTG
SWTQLYLITDYHENGSLYDYLKSTTLDTKAMLKLAYSTVSGLCHLHTEIFGTKGKPAIAH
RDLKSKNILVKKNGTCCIADLGLAVKFISDTNEVDIPPNTRVGTKRYMPPEVLDESLNRN
HFQSYIMADMYSFGLILWEVARRCISGGILEEYQLPYHDVVPSDPSYEDMREIVCIRRFR
PSFPNRWSSDECLRQMGKLMTECWAHNPASRLTALRVKKTLAKMSESQDIKL
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgggttggatggaagaaagaaattggcagcttcacgtttccttgattatgctgctctcc
ctgcatacaagagcaaatctgcttgataacatgctgctaagaagttctgcaaagctaaat
gtggacagcaggaaggaagacacagaaagcacagctcccgctccgccgcagaagatgctg
gcatgttactgccatcaccactgtccagaagactctttcaataacacctgctggactgat
ggctattgctttactatcgtggaagaagatgaatctggccttcccgtagtcacttctggc
tgcttgggattagagggatctgacttccaatgtagggatacaccaataccccatcagcgg
agatcaattgaatgttgcaccgatgaagacttttgtaacagagatctccatcccacatta
cctcctcttaaaaaaccagattttgttgatgggagtatccactacatggcattgcttatt
tctgtgactgtctgcagcatcatcctggccattattctgatattctgttacttcaggtat
aagcgacaggaagccagaccccgttacagcattggaattgagcaggatgagacatacatt
cctcctggagagtcactgaaggatctcattgaacagtcacaaagctcaggaagtggctcg
gggctccctctgctggtccaaaggacaatagcaaagcaaatacagatggtgaagcaaatt
ggcaaagggcggtatggagaggtctggatgggtaaatggcgaggagagaaggtggctgtg
aaagtgttcttcacaacagaagaagcaagttggtttcgagagacagaaatctaccagact
gtgcttatgcgacatgaaaacatactgggcttcattgcagctgatatcaaagggaccggg
tcatggactcaactctatttgattacggactatcatgaaaatggctctctctatgattac
ctgaagtctaccaccctggatacaaaggcaatgctgaagctagcctattcaacagttagc
ggcctctgccacctgcacactgaaatttttggaacaaaaggaaagccagctatcgcccac
agggatcttaaaagtaaaaatatactggtgaagaaaaacggaacatgctgtattgcagac
ctgggactggcagtaaaattcattagtgacacaaatgaagtggacattccgccaaacacc
agagttggtacaaagcgctatatgcctccagaggtgcttgatgagagcttaaacagaaat
cactttcagtcctatatcatggcagatatgtatagctttggactcatcctttgggaagta
gccagaagatgcatatcaggaggtatattggaggaataccagctgccctaccatgatgtg
gtacctagcgacccatcttatgaagacatgagagaaattgtctgtatcaggaggtttcga
ccttcatttccgaatagatggagcagcgatgagtgtttgagacagatgggaaagctcatg
acagagtgttgggctcacaatccagcctcacgcctcacagctctgcgagtaaagaagacc
ttagccaaaatgtcagagtctcaagatatcaagctttga

DBGET integrated database retrieval system