KEGG   Xenopus tropicalis (western clawed frog): 780100Help
Entry
780100            CDS       T01011                                 

Gene name
abcb6
Definition
(RefSeq) ATP binding cassette subfamily B member 6 (Langereis blood group)
  KO
K05661  ATP-binding cassette, subfamily B (MDR/TAP), member 6
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    780100 (abcb6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xtr02000]
    780100 (abcb6)
Transporters [BR:xtr02000]
 ABC Transporters, Eukaryotic Type
  ABCB (MDR/TAP) subfamily
   ABCB6, 7 subgroups
    780100 (abcb6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MTABC_N ABC_membrane ABC_tran SMC_N AAA_16 AAA_22 AAA_29 RsgA_GTPase AAA_24 AAA_21 AAA AAA_30 AAA_15 SbcCD_C AAA_5 NTPase_1 AAA_18 DUF815 MMR_HSR1 AAA_23 Cytidylate_kin
Motif
Other DBs
NCBI-GeneID: 780100
NCBI-ProteinID: NP_001072643
Xenbase: XB-GENE-1001119
UniProt: Q08D64
Position
9
AA seq 849 aa AA seqDB search
MVRLGSYCEHNGSISQAWLDSGLSPCFYFTLVPSVLLSFSFLLGALQSALYARHSTTMEP
KYIPRSRLYRLQIVLSVVLILQSVIGLIWQAAGTDVVYGYMIVHGCLSVVAWGFSLWLLH
LERTRALVREKSRGHGVVLLLFWALAFAAENLAFISWQSPNWWWLSRDTVPQKVQFGLWI
TRYVCTLFLFVLGIRAPGRPRKPYIVLINEDERDVETSQPLLRDPNQSTWQGFKKKLLLV
MQYIWPRRNIPLQLLVALCMGLMGLERAINVFVPIYAKKIVDGLTEDSTWNILAVTVCIY
VLLKFLQGGGAGTTGFLSNLRTFMWIRVQQFTNREVQIRLFAHLHSLSLRWHLGRKTGEV
LRSVDRGTSSINSLLSYIVFSILPTIADIVIGIVYFTSSFNAWFGLIIFVCMTLYLTLTI
IITEWRTKYRREMNTRDNEAKSRAVDSLLNFETVKYYNAEGYEVGRFNDSIMKYQVSEWK
VNASLAMLNQTQNLIIGLGLLAGSLLCAYFVTENKFKVGDYVLFGTYIIQLYTPLNWFGT
YYRMIQSSFIDMENMFELFNEDQEVKDAVNAPALMFRSGKIEFENVHFSYLDGKEILRDI
SFTVMPGQSIALVGPSGSGKSTIIRLLFRFYDVKGGTIKVDGQDISTVRQESLRSHIGVV
PQDTVLFNDTIRNNIRYGRVSATDDEVEEAAAAADIHERILSFRDGYDTQTGERGLKLSG
GEKQRVAIARTILKAPQIILLDEATSALDTETERNIQASLAKVCANRTTIVVAHRLSTVI
NSDQILVLKEGQIVERGRHEELLLKGGVYAGMWQKQQSGSESSSDSDSERKDRTSEKLQP
PKATPRRGH
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgactgggcagttactgtgagcacaatggcagcatttcccaggcctggctggat
agcggcctctccccttgcttctacttcaccctggtcccctccgtgctcctgagtttttct
ttcttattaggggccttacagtctgccttgtatgcccggcacagcaccaccatggaaccc
aagtacatcccacggtcacgtctctaccgccttcagatagtgctgtctgtggtgctgata
ctgcagtctgttataggcctgatctggcaggctgcaggcaccgatgtggtgtatggctac
atgattgtgcatggctgcctgtctgtagtggcctggggattcagcttgtggctccttcat
ttggagaggacaagggccctagtgagagagaagagccggggccatggagttgtgctgtta
ctattctgggcactggcctttgctgctgagaacctggcatttatttcatggcagagtccg
aactggtggtggttatcgagggataccgtgccacagaaggtgcagtttggcctgtggatt
acacggtatgtgtgcacactcttcctcttcgtactgggaatccgtgcccctggcagacca
cgcaagccttatattgttcttataaatgaggatgaaagggatgtggagacttcacaacct
cttctgagagatccaaaccaatccacctggcagggtttcaaaaagaagttacttctggtt
atgcagtacatttggccacgtaggaacataccactgcagctactggtggctctgtgcatg
gggctgatgggattggagcgggccattaatgtcttcgttcccatatatgcaaagaaaatt
gtggatgggctaacagaggattctacatggaatatactggctgtgactgtctgtatttac
gttcttctgaagttcctacaaggtggaggagcaggtacgactgggtttctcagcaatttg
cggaccttcatgtggatacgagtccaacagttcaccaaccgggaggtgcagatccggctc
ttcgcccaccttcactccctttccctacgttggcatcttggtcgcaagacgggggaagtg
ttacgcagcgtggacaggggaaccagcagtatcaacagccttctcagttatattgtgttc
agcatactgcccaccattgctgatattgttattgggattgtctacttcacgtcttccttc
aacgcctggtttgggctcatcattttcgtctgtatgaccttgtatttaactctgaccatc
attatcaccgaatggagaaccaagtatcgccgggagatgaataccagagacaatgaggcc
aaatcccgcgctgtagactccttgctgaactttgaaacggtgaagtactataatgcagaa
ggctatgaagtgggcagatttaatgattcaattatgaaatatcaggtttctgaatggaaa
gttaatgcttcgcttgccatgctgaaccaaacccagaatcttatcattggacttgggctg
ctggctgggtctctactttgtgcatactttgtaactgaaaataagtttaaggtgggcgac
tatgtgctcttcggaacatatattatccagctgtatacacccttgaactggtttggcaca
tactacaggatgattcagagttctttcattgatatggagaatatgtttgaactcttcaat
gaagaccaggaggtgaaggatgcagtaaatgccccagctctcatgttccgctctggaaag
atagagtttgagaatgtccatttcagctatctggatggtaaagaaatactacgggatata
tcatttacagtaatgccaggacagagtatagcactggtgggtccatctggttctgggaaa
agcaccattatacgcctcctgttccgcttttatgatgtcaaaggaggtactattaaggtt
gatggtcaggacatttccacggtccggcaggaatcactacgctctcacattggggtggta
cctcaggacacggtgctatttaatgatacaattcggaacaacatacgctatgggcgggtc
agtgccacagatgatgaagtggaggaagctgcagctgctgctgatatacatgaacgcatt
ctttctttccgcgatggatatgacacacagactggagagcgaggactgaagctgagtgga
ggagagaagcagcgggtcgctatagctcgaaccattctgaaagcgccacagattatccta
ctggatgaggccacctctgccctggacactgaaacagagagaaatatccaggcatctctg
gccaaagtctgtgctaatcggacaactattgtggttgcccataggctttcgactgtaata
aattccgatcagatccttgtgctgaaagaagggcagatagtagaacgtgggagacacgaa
gaactcctacttaaagggggagtctatgctggaatgtggcagaagcaacagagcggcagc
gaatcttcctcagactctgattctgaaagaaaagatcggacctcagagaaattgcagccc
cccaaagcaacaccaagaagaggccattaa

DBGET integrated database retrieval system