KEGG   Xenopus tropicalis (western clawed frog): 780187
Entry
780187            CDS       T01011                                 

Gene name
htra1
Definition
(RefSeq) serine protease HTRA1 precursor
  KO
K08784  HtrA serine peptidase 1 [EC:3.4.21.-]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:xtr01002]
    780187 (htra1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:xtr03110]
    780187 (htra1)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     780187 (htra1)
Peptidases and inhibitors [BR:xtr01002]
 Serine peptidases
  Family S1: chymotrypsin family
   780187 (htra1)
Chaperones and folding catalysts [BR:xtr03110]
 Other chaperones and cochaperones
  DegP / HtrA
   780187 (htra1)
SSDB
Motif
Pfam: Trypsin_2 Trypsin PDZ_6 PDZ_2 PDZ Kazal_2 IGFBP Peptidase_S46 Kazal_1 Peptidase_S32 GRASP55_65 Tricorn_PDZ
Other DBs
NCBI-GeneID: 780187
NCBI-ProteinID: NP_001072730
Xenbase: XB-GENE-487699
UniProt: A4IHA1
Position
7
AA seq 460 aa
MAMLWLAVLLTCGAPAALLPTSGVGCPSRCDPASCAPAPTNCPAGETALRCGCCPVCAAA
EWERCGEGPEDPLCASGLRCVKNGGVARCQCPSNLPVCGSDGKTYPSLCRLQAESKAAQG
KGSAAIIPIQRGDCQQGQRDPDSPRYKYNFIADVVEKIAPAVVHIELFRMLPFFKREVPA
ASGSGFIVSEDGLILTNAHVVTNKHRLKVERSDGSTYDAQIIDVDEKADIALIKIKAKGK
LPVLLLGRSEDLRPGEFVVAIGSPFSLQNTVTTGIVSTAQRGGKELGLRNSDMDYIQTDA
IINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKIRKFLAESHNRQSTGQGTKKKK
YLGIRMMSLSQGKLKELKEQVKDFPENTSGAYIVEVIPDTPAEEAGLKEGDIIISIGGKS
VTSSSDVSDAIKKEGTTLHLVIRRGNEDIPISVTPKEIEF
NT seq 1383 nt   +upstreamnt  +downstreamnt
atggccatgttgtggctggcagtgctactgacctgcggagcccccgctgctctccttcca
acctccggggtgggctgcccgtcccgctgtgaccccgcctcctgtgccccggcccctacc
aactgcccggcgggggagacggccctgcgctgtgggtgctgcccggtctgtgccgccgcc
gagtgggagcgctgtggggagggacctgaggatccgctgtgcgcctccgggctgcgctgt
gtgaagaatggcggggtggcgaggtgccagtgtccctccaacctaccggtctgtggcagc
gacggcaaaacctaccccagcctgtgccgcctccaggccgagagcaaagcggctcaaggg
aagggatccgccgctatcatccccatccagaggggcgactgtcagcaaggacagagggac
ccggacagcccgcgctataagtacaacttcatcgctgatgtggtggagaagatcgccccc
gctgtcgtccatattgagctcttccgcatgctccctttcttcaagcgcgaggtgccggca
gccagcggctctgggttcatcgtgtcggaggatgggctcatactgaccaacgcccatgtc
gtgactaacaagcatcggttgaaagtggaacgcagcgatggctccacctatgatgcgcag
atcattgacgtcgatgagaaggcagatatcgcccttatcaagatcaaagcaaaggggaag
ttgccggttctgctgttgggtcgttcggaggacctgcgcccgggcgagtttgtagtcgcc
attgggagccctttctcccttcagaacactgtgacgactgggattgtgagcactgctcag
cgtgggggcaaagagctgggtctacggaactctgacatggattatattcagaccgacgcc
attatcaattatggaaactctgggggccccctcgtcaatctggacggtgaagtgatcggt
ataaacaccctgaaggtgacggcggggatctccttcgctattccgtctgataaaatccgc
aaattcttggcggagtcgcacaacaggcaatctacaggtcagggcactaagaagaagaaa
tacctggggatacggatgatgtcactgagccaagggaaactgaaggagctcaaggagcag
gtgaaggatttcccagagaacacctcaggagcttatatagtagaagtgatcccagacacc
ccagctgaagaggctggcttgaaggaaggcgatataataatcagcataggtggcaagtct
gtgacctccagcagtgatgtcagcgacgccattaagaaagagggcaccactctacacttg
gtgatacgccgtggcaacgaggacatccccatctctgtgacacccaaggaaatagaattt
taa

DBGET integrated database retrieval system