KEGG   Xenopus tropicalis (western clawed frog): 780381Help
Entry
780381            CDS       T01011                                 

Gene name
cdk15, als2cr7, pftk2
Definition
(RefSeq) cyclin-dependent kinase 15
  KO
K15594  cyclin-dependent kinase 15 [EC:2.7.11.22]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xtr01001]
    780381 (cdk15)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     780381 (cdk15)
Protein kinases [BR:xtr01001]
 Serine/threonine kinases: CMGC group
  CDK family
   780381 (cdk15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Seadorna_VP7 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 780381
NCBI-ProteinID: NP_001072919
Xenbase: XB-GENE-961241
UniProt: Q0V9R1
Position
9
AA seq 300 aa AA seqDB search
MKAEEGVPFTAIREGSLLKGLKHANIVLLHDIIQTRETLTFVFEYVHTDLAQYMSQHPGG
LLPYNVRLFMFQLLRGLAYIHHQHILHRDLKPQNLLISYIGELKLADFGLARAKSIPSQT
YSSEVVTLWYRPPDVLLGATDYSTDLDIWGAGCIFIEMLQGYPAFSGVSDIFEQLEKIWS
VIGTPAEDSWPGVSMLPNYKTEWLTLQEYQPFGNVWDGLGRSMGAEDLAEKMLKGCPRER
ISAEDALLHKFFSTLPCQLHQLPDVRSIFTVPGLSLKPEIHDLYISHRKGSKPDTHHRLW
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagaagaaggagtgcccttcacagcaattcgtgaagggtcactactcaagggt
ctgaaacatgccaatattgtcctgctccacgatatcatccagaccagggaaaccttaact
tttgtttttgaatatgtgcacacagatctggcacagtacatgtcccagcatcctggagga
cttcttccctacaatgtcaggctcttcatgttccagctgttgagaggcctggcctatatc
catcaccagcacatcctccatcgagacctcaagccccagaatcttctcattagctacata
ggagaactaaaacttgctgactttggacttgcccgggccaagtctattcccagccagaca
tactcctcagaagtggtgacactatggtaccgcccaccagatgtgcttcttggggccaca
gattattccactgaccttgacatctggggcgcaggatgtattttcatagaaatgcttcag
ggttacccagctttctctggagtatcggatatttttgagcagcttgaaaagatctggtcg
gtaattgggactccagctgaagattcctggcctggagtgtcaatgcttccaaactacaaa
acagaatggcttactttacaagaatatcagccatttggaaatgtgtgggacggattgggc
aggtcaatgggagctgaggatcttgcagagaagatgctgaaaggttgtcctcgagaaagg
atctctgcagaggatgccctgcttcacaaatttttcagtactctaccatgtcagctacac
cagctcccagatgtgcggtctattttcacagtgccaggactaagtcttaaaccagaaatc
catgatctatacatttctcatcggaagggctccaagccagatacacatcacaggctctgg
tga

DBGET integrated database retrieval system