KEGG   Xylella taiwanensis: AB672_01615Help
Entry
AB672_01615       CDS       T05568                                 

Definition
(GenBank) gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
xtw  Xylella taiwanensis
Pathway
xtw00430  Taurine and hypotaurine metabolism
xtw00460  Cyanoamino acid metabolism
xtw00480  Glutathione metabolism
xtw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xtw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    AB672_01615
   00460 Cyanoamino acid metabolism
    AB672_01615
   00480 Glutathione metabolism
    AB672_01615
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:xtw01002]
    AB672_01615
Enzymes [BR:xtw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     AB672_01615
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     AB672_01615
Peptidases and inhibitors [BR:xtw01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   AB672_01615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AXI82752
UniProt: Z9JKT2
Position
414453..416213
Genome map
AA seq 586 aa AA seqDB search
MRLFTRCLLLFFVFFLFSQVSAEQRVTALPQDGVARFPPGAVIASSHHLATEAGLEILRQ
GGNAFDAAVAVSSTLSVVQPISSGLGGGGFFLLHDAKTGRDVMLDAREYAPASVKPGTFL
NTDGQLDRDRSINGPWSAGIPGLPAALVELAEHYGKLPLRQTLAPAIHIAGAGFPIYRRM
AEGYRARREVMERYPGTRDVYLRGGKPIAGGDIFKQPELARTLSLLADKGFDGFYKGETA
QRLLAGVNQAGGRWTAEDLAGYRVKSRAPISFNYRGWKITTAPPPSSGGIALAEMLQILE
GWDLTRLDEVHRVHLVVEAMRRAYRDRTFFLGDPDFVSIPQRVLTSKDYARGLRAAINPE
KALPSVLLSGHPTPLEDEETTHFSIIDAEGNRVGATQTVNLLYGSGLIPKGTGVLLNNEM
DDFALQPGAPNVFGVMGYEANAPKPGKRMLSSMTPTFLESADKVAVIGTPGGSRIITMVL
LGILGYDAGLDAQQVAALPRYHHQWLPDVIETEAATFSAEVIKGLEAMGHTLREPSDTVA
GGRGSSHVWGNVQTVEWDRRSNRLSAASDPRDSLGEAKVLLTEEKR
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgaggttatttactcgttgtttgttgttgttctttgttttttttcttttctcgcaagtt
tcggcggagcaaagggttacagcgctgccacaggacggagtcgccagattcccacctggt
gcggtcattgccagcagtcatcatctggcgactgaggctgggctggagatcctgaggcag
ggaggtaatgctttcgatgctgcagttgccgtgtcttccacgctgtcggtggtccaaccc
atcagttccggtttgggaggcggcggtttttttctgcttcatgatgccaagactggtcgc
gatgtcatgctggatgcccgggaatacgcgccggcttcagtcaaaccaggtacgtttcta
aacacggacggtcagctagatcgtgatcgctcgatcaacgggccctggtcggcagggatc
cctggtttaccggcagcactcgttgaattggctgagcactatggcaagctcccattgaga
cagacattggcaccggcgatccatattgcgggtgcggggtttccaatttaccgacgcatg
gcggagggctatcgggcgcgccgcgaagtgatggagcgttatccaggtacccgtgacgtc
tacctccgcggcggtaagccgatcgctggaggtgatatcttcaaacagcctgaattggca
cggaccttgagtttattggctgataagggcttcgatggcttttataagggcgagactgcg
cagcggttgctagctggggtgaatcaggcgggtggacgttggacagctgaagatctggct
ggctaccgggtcaaatcacgtgctccaatcagttttaattaccgcgggtggaagatcacc
acggcaccgccgccgtcctctgggggtatcgcgttggcggaaatgttgcagatcctggaa
ggctgggatctcactcgactggatgaagtgcatcgtgttcatttggtggtagaagccatg
cgccgtgcctatcgagatcgtaccttctttctcggtgacccggattttgtctcgattcca
cagcgtgtgctgactagcaaggactacgcgcgtggcttgcgcgctgcgatcaaccctgaa
aaagcgctgcctagcgtcctgttatcaggtcatccgactccactggaggatgaggagacc
acgcacttttcgatcattgatgcggaaggaaaccgggtgggtgcgacgcagacggttaat
ttgctatatggctcgggtctgattccgaaggggaccggcgtgttgctgaacaatgagatg
gatgattttgcgctccagccaggcgcgccgaatgtcttcggggtgatgggctacgaggct
aacgcaccaaaaccagggaagcgcatgctcagctcgatgacaccgaccttccttgaatct
gcagataaagtggccgtgattggcactcctggcggtagccgcatcatcacgatggtgctg
ttagggatcctgggttacgacgccgggttggatgcacagcaggtcgccgcgttgccgcgt
tatcatcatcagtggctgccggatgtgattgagaccgaggcagctacattttcggcagag
gtgatcaagggattggaagcgatgggacatacgcttagggagccaagcgacacggttgcc
ggcgggcgtggttccagccacgtgtggggcaacgtgcagacggtggaatgggatcgccgt
tccaataggctcagtgctgctagtgatccgcgtgattccctgggtgaggcaaaggttttg
ctgactgaagagaagcggtga

DBGET integrated database retrieval system