KEGG   Xylella taiwanensis: AB672_09255Help
Entry
AB672_09255       CDS       T05568                                 

Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
xtw  Xylella taiwanensis
Pathway
xtw00230  Purine metabolism
xtw00250  Alanine, aspartate and glutamate metabolism
xtw01100  Metabolic pathways
Module
xtw_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:xtw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AB672_09255
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AB672_09255
Enzymes [BR:xtw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     AB672_09255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AXI84108
UniProt: Z9JMC6
Position
complement(2157514..2158806)
Genome map
AA seq 430 aa AA seqDB search
MGQSVVVLGAQWGDEGKGKIVDLLTEEIGAVVRFQGGHNAGHTLVINGKKTVLHLIPSGI
LREGVLCLIGNGVVISPAALREEIEGLEETGLEVCSRLKISPAAPLIMEYHIALDQAREK
AAGGRAIGTTGRGIGPAYEDKIGRRGIRVADLHYPDQLEQKLRAALDYHNFVLTKYFGVD
AVDFQRIYDEVLLFGEYVEPMKSDVAGILHDLRKQGKRVLFEGAQGTLLDIDHGTYPYVT
SSNTTVGGALNGAGVGVQGIDYVLGIAKAYATRVGGGPFPTELDDEIGQGIRDRGVEYGA
STGRPRRCGWMDIVALKRAVAINGITGLCITKLDVLDGMDKLKVCIAYEYHDKRSEYAPL
DVQGWEECTPVYLEFPGWNENTHGITAWDKLPPAARAYLRALEELAGCPIGIVSTGPDRE
HTIMLQDPFA
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgggtcagtcagttgtcgtgctcggtgcccagtggggcgatgaaggtaagggcaagatc
gtcgaccttctcaccgaggaaattggcgcggttgtgcgctttcagggaggtcacaatgct
ggtcacactttagttatcaacggtaagaagactgttttgcatcttattccatctggaatc
ctgcgagagggtgtgctatgcctgattggtaacggtgtagtcatctcgccagccgcattg
cgagaggagatcgaggggctggaagagaccggtttggaggtatgctcccgtttgaagatt
tcgcccgctgcgccgttgatcatggaatatcacattgccctggatcaagcacgtgagaag
gctgctggtggcagggcgattggtactaccggtcgcggtattgggccggcgtacgaggac
aagatcggtcgccgtggtattcgtgtggctgatcttcattacccagatcaattggagcag
aagctacgtgctgcgctggactatcacaattttgtgttgactaaatatttcggtgtggat
gcggtggactttcagcggatctatgacgaggtgttattgtttggggaatacgtcgagccg
atgaagtcggatgttgcgggcatcctccatgacctgcgcaagcaaggcaagcgtgtgctt
tttgagggtgctcagggcacattgctggacattgatcacggcacctatccgtacgtgacc
agctccaacacgacggttggtggtgccctcaatggcgctggtgttggtgtgcagggtatt
gactatgtgttgggcattgctaaggcttatgccactcgtgtcggtggggggccatttcct
accgagttggatgatgagatcggccagggtatccgagatcgtggggtcgagtacggtgct
tctaccggtcgtccgcgccgctgtggttggatggacattgttgcactcaagcgtgcggtt
gccatcaatggtattaccggtttgtgtatcaccaaactggatgttctggatggaatggat
aagcttaaggtctgtattgcctatgagtaccacgataaacgtagtgaatacgctccgtta
gatgtacagggttgggaggaatgcaccccggtgtacttggaattcccaggctggaacgag
aacactcatggcattactgcgtgggacaaacttcctccagcggcccgtgcttacctgcgt
gcattggaagagctcgctggttgtccgattggtattgtgagcaccggcccggatcgtgag
catacgattatgttgcaagatccttttgcttga

DBGET integrated database retrieval system