KEGG   Xanthomonas vasicola: C7V42_02485Help
Entry
C7V42_02485       CDS       T05388                                 

Definition
(GenBank) aminotransferase class V-fold PLP-dependent enzyme
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
xva  Xanthomonas vasicola
Pathway
xva00260  Glycine, serine and threonine metabolism
xva01100  Metabolic pathways
xva01110  Biosynthesis of secondary metabolites
xva01120  Microbial metabolism in diverse environments
xva01130  Biosynthesis of antibiotics
xva01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xva00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C7V42_02485
Enzymes [BR:xva01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     C7V42_02485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AVQ05676
UniProt: A0A315GH14
Position
554806..555867
Genome map
AA seq 353 aa AA seqDB search
MDGQGSNARISFRNDYSEGAHPRLLQALAQASAEQHAGYGTDRHTARAVALIRNAVAQPQ
ADVHLLVGGTQTNLIAISAFLRPHQAVIAVEAGHIATHETGAIEATGHKVLTVPALHDKL
TPALIEPLLAVHSNEHMVQPRLVYISNSTESGTIYTRAELDALSRFCHANDLLLYLDGAR
LGAALTADGNDLDLPTVAALTDAFYIGGTKNGALLGEALVIVNPALQADFRYLIKQRGAL
LAKGMVLGVQFAALFEGGLFFELATHANAMAQRLRAGLLAARAHFTSDSPTNQQFIAISA
QHAAQLAQRYDFERWEVRPDGSHVIRFVTSWATTLEAVDRLCADVAALQRGVP
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggacgggcagggcagcaatgcgcgcatcagctttcgtaacgactacagcgaaggcgcg
catccgcgtctgctgcaggcgttggcgcaggccagcgccgagcagcacgccggctacggt
accgatcggcacacggcgcgtgcggttgcgttgatccgcaatgcagtcgcgcagccgcag
gccgacgtgcatctgctggtcggcggcacgcagaccaatctgatcgcgatcagcgcgttt
ttgcgcccgcatcaggcggtcatcgcggtggaggcggggcatatcgccacgcacgaaacc
ggggcaatcgaagcgactgggcacaaggtgctcactgtgccggcgctgcacgacaagctg
acccctgcactgatcgagccactgctcgctgtgcacagcaacgaacacatggtgcagcca
cgcctggtctatatttccaacagcaccgaaagcggcaccatctacacacgtgccgaactt
gatgcgttgtctcggttctgccatgcaaacgatctgctgctatatctggatggcgcacgc
ttgggcgccgcgctgaccgccgacggcaacgatctggatctgcccacagttgccgcgctc
accgacgcgttctacatcggtggcaccaagaatggtgcgctgctgggcgaagcgctggtc
atcgtcaatcccgccctgcaggctgattttcgctatctgatcaagcagcgcggtgcgttg
ctggccaagggcatggtgctcggcgtgcaattcgccgcgttgttcgaaggcggtctgttt
tttgaattggcgacgcatgccaacgcaatggcacaacgcttgcgcgccggcctgcttgcc
gcacgcgcacacttcacaagcgactcgccgaccaatcagcagttcatcgccatcagcgcg
caacacgcagcgcagctggcgcaacgctacgacttcgagcgctgggaagtgcgccccgat
ggcagtcacgtgatccgcttcgtcacttcgtgggcaaccacgcttgaggcggtcgatcgc
ctgtgtgcggatgtggcggcactgcagcgcggcgtgccgtaa

DBGET integrated database retrieval system