KEGG   Xanthomonas vasicola: C7V42_16560Help
Entry
C7V42_16560       CDS       T05388                                 

Definition
(GenBank) sensor histidine kinase
  KO
K02668  two-component system, NtrC family, sensor histidine kinase PilS [EC:2.7.13.3]
Organism
xva  Xanthomonas vasicola
Pathway
xva02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xva00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    C7V42_16560
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xva01001]
    C7V42_16560
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:xva02022]
    C7V42_16560
   02035 Bacterial motility proteins [BR:xva02035]
    C7V42_16560
Enzymes [BR:xva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     C7V42_16560
Protein kinases [BR:xva01001]
 Histidine kinases
  NtrC family
   C7V42_16560
Two-component system [BR:xva02022]
 NtrC family
  PilS-PilR (type 4 fimbriae synthesis)
   C7V42_16560
Bacterial motility proteins [BR:xva02035]
 Pilus system
  Twitching motility proteins
   C7V42_16560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HATPase_c_2 PAS_8 PAS MLTR_LBD
Motif
Other DBs
NCBI-ProteinID: AVQ07976
UniProt: A0A315F5Z4
Position
3628489..3630102
Genome map
AA seq 537 aa AA seqDB search
MASIASLIARIQSAPQRELYFFSLYRVLVAGLIAALVFSPLSDAIPEPRYPPLAAGVAIG
YLCMAIPLLFWGRSERRLTPTVLCAVVADILAATLATHALPGASAGIAMMLLFNVAAASI
LLRLRYGMSIAVLASAAILLEYLWTLLEGGGATRPVAELAMFATSYVAVAFICEQIASRA
RRNQVLAEERGAQVANLYEINELIIRRMRTGVLVVDTHNRISLANEAALALLGDGDPRNA
PADLSLVALTPELARRLQRWRSGWRQEEAPLQLGADRPEVQPRFVRLLADSDLVLVFLDD
ATVVSRRAESLTLSAMGRFSASLAHEIRNPLAAISYASQLLEESPDIGDADRRLLQIIHQ
QCQRTNGIVESVLALARRERATPDNLDLAAFVRRFVVEYRQTLSMETDILEASMQGSTVH
ALVDPKHLHQILTALVHNALKYGRVMDEPARVKLRVERVERMAVINVMDRGPGIPEAVAA
QLFRPFYTTSEHGTGLGLYIAQELCRANQAQLEYVSIPGGGACFRISLQGPNSLLGR
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
ttggcatccatcgcatcgctcatcgcccggatacagtccgcgccgcagcgcgagctgtac
ttcttctcattgtaccgggtgctggtggccggcctgatcgccgcgctggtgtttagcccc
ttgtccgacgccatccccgagccgcgctacccgcccctggccgcaggcgtagcaatcggc
tacctgtgcatggcgatcccgctgctgttttggggccgcagcgagcgccgcctgacgccc
accgtgctatgcgcggtggtggctgacatcctggccgcaaccctggcaacgcacgccctg
cccggcgccagcgccggcattgcgatgatgctgctgttcaacgtggcggccgcctcgatc
ctgctgcggctgcgctatggcatgagcatcgcagtgcttgccagcgcggccatcctgctg
gaatacctgtggaccctgctcgaaggcggcggcgccacccgaccggtcgccgagctggcc
atgttcgccaccagctatgtcgcggtggccttcatctgcgaacagatcgcctcgcgcgca
cggcgcaatcaggtattggccgaagaacgcggcgcgcaggtcgccaatctgtatgaaatc
aatgagctgatcatccgacgcatgcgcaccggcgtgctggtggtggacacccataaccgc
atctcgttggcaaacgaggcggcattggccctgcttggcgatggcgacccgcgcaacgca
ccggccgatctctcgctggtggcacttaccccggagctggcgcgccggctacagcgctgg
cggagtggctggcgtcaggaagaagccccgctgcaactcggcgccgaccgcccggaagta
cagccgcgcttcgtgcgtctgctcgccgacagcgacctggtactggtgtttttggacgac
gccacggtggtgtcgcgtcgcgccgagtcgctgaccctgtcggccatgggacgcttctcg
gccagcctggcgcacgagatccgcaacccgctggccgccatcagctacgcctcgcagttg
ctggaggaatcgccggacatcggcgatgccgaccgccgcctgctgcagatcatccaccag
caatgtcagcgcaccaacggcatcgtcgaaagcgtgctcgcactggcgcggcgggaacgc
gccactcctgacaacctggacttggccgcattcgtgcggcgcttcgtggtcgagtaccgg
cagactctgtcgatggaaaccgacatcctggaagccagcatgcagggcagcaccgtgcat
gccctggtcgatcccaagcacctgcatcagatcctcaccgcgctggtccacaacgcactc
aagtacggccgcgtcatggacgaaccggcacgggtcaagctgcgcgtcgaacgcgttgaa
cgcatggcggtgatcaatgtcatggaccgcggccccggcatcccggaagccgtggccgcg
caactgttccgcccgttctataccacctccgaacacggcactggcctgggtctgtacatc
gcccaggaactctgccgcgccaaccaggcgcaactggagtatgtctcgatccccggcggc
ggcgcatgtttccgcatttcgttgcaaggcccaaacagcttgctggggaggtga

DBGET integrated database retrieval system