KEGG   Xanthomonas vesicatoria: BJD12_02835Help
Entry
BJD12_02835       CDS       T04741                                 

Definition
(GenBank) cysteine--tRNA ligase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
xve  Xanthomonas vesicatoria
Pathway
xve00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:xve00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BJD12_02835
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:xve01007]
    BJD12_02835
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xve03016]
    BJD12_02835
Enzymes [BR:xve01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     BJD12_02835
Amino acid related enzymes [BR:xve01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   BJD12_02835
Transfer RNA biogenesis [BR:xve03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BJD12_02835
 Prokaryotic type
    BJD12_02835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e DALR_2 tRNA-synt_1 tRNA-synt_1g tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: APP74368
UniProt: F0BJ62
Position
643918..645348
Genome map
AA seq 476 aa AA seqDB search
MPMSLRLHNNLTRRVEPFAPLDPSCPTLYVCGPTVYNYAHIGNARGPVVFDVLAALLRRR
YGALRYARNITDVDDKINAAAQAQGVPISTITHRFAAIYRQDMAALGVVPPDIEPEATAH
IPQIVAMIEQLIANGHAYAAEGHVLFAVASFDGYGKLSRRDPDEMLAGARVDVAPYKRDP
GDFVLWKPSTDDLPGWESPWSRGRPGWHIECSAMAAAHLGPTIDIHAGGVDLQFPHHENE
IAQSECAHGGATFARFWLHNGMLNFSGAKMSKSLGNIETVHDLIAKHPPEALRLALVSAH
YRQPLDWSDGLIEQAKNTLDRLYGTLRDVAALDAGDAPDGSASPAIPAEVEAALDDDLNT
PQALSIIASIAAEARALRNQVTHGADISARRAELREIKTRLLGAGLALGLLQQDPAAWFA
RGTNAGDDARITALVEERSTAKKAKDFARADAIRKQLADEGIVLEDTPQGVRWKRA
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgccgatgagcctgcgcctgcacaacaatctgacgcggcgggtcgaaccgttcgcgccg
ctcgacccgtcctgccccaccctgtatgtgtgcggccccaccgtctacaactacgcgcat
atcggcaacgcccgtggcccggtggtcttcgacgtgctggccgcgctgctgcgccgccgc
tatggcgcgctgcgctacgcacgcaacatcaccgatgtggacgacaagatcaacgccgcc
gcacaggcgcagggcgtgccgatctccaccatcacccaccgcttcgccgcgatctaccgc
caggacatggccgcgctgggcgtggtaccgccggacatcgagccggaagccaccgcgcat
attccacagatcgtggcgatgatcgagcagctgatcgcaaacggccatgcatacgccgca
gaaggccatgtgctgtttgcggtggccagtttcgacggctacggcaagctgtcgcgccgc
gacccggacgaaatgctggccggcgcacgcgtggacgtggcgccgtacaagcgcgacccg
ggcgatttcgtgctctggaagccgtccaccgacgacctgcccggctgggagtcgccatgg
agccgcggccgtcccggctggcatatcgaatgctcggcaatggccgctgcccacctgggc
ccgaccatcgacatccatgccggtggcgtggacctgcagttcccgcatcacgaaaacgaa
atcgcgcaaagcgaatgcgcgcatggcggcgctacctttgcgcggttctggctacacaac
ggcatgctcaacttcagcggcgccaagatgagcaagtcgctgggcaatatcgaaaccgtg
cacgacctgatcgcaaagcatccgcctgaagcgctgcgtcttgcgctggtgagcgcgcac
taccggcagccgctggattggtcggacggcttgatcgaacaggccaagaacacgctggac
cgattgtacggaacgttgcgggatgtggccgcgctggacgcaggcgacgcaccggacggt
agcgcatcaccagcgattcccgccgaagtggaggctgcgctggatgacgacctcaacacg
ccgcaggccttgtcgatcatcgccagcatcgctgcagaggcgcgtgcactgcgtaatcaa
gtgacccacggtgcagacatatcggcgcgccgtgccgaactgcgtgagatcaaaacccgg
ttgctgggcgcaggcctggcactcgggctactccagcaggacccggctgcctggttcgcg
cgcggcaccaatgccggcgacgatgcgcgcatcactgccctggtcgaagaacgcagcacg
gcgaagaaagccaaggatttcgcccgcgccgacgccatccgcaagcagctcgccgacgaa
ggcatcgtgctggaagacaccccgcaaggcgtgcgctggaagcgcgcatga

DBGET integrated database retrieval system