KEGG   Xanthomonas vesicatoria: BJD12_11105Help
Entry
BJD12_11105       CDS       T04741                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
xve  Xanthomonas vesicatoria
Pathway
xve00030  Pentose phosphate pathway
xve00480  Glutathione metabolism
xve01100  Metabolic pathways
xve01110  Biosynthesis of secondary metabolites
xve01120  Microbial metabolism in diverse environments
xve01200  Carbon metabolism
Module
xve_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
xve_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
xve_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:xve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BJD12_11105
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BJD12_11105
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xve04147]
    BJD12_11105
Enzymes [BR:xve01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     BJD12_11105
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     BJD12_11105
Exosome [BR:xve04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BJD12_11105
  Exosomal proteins of colorectal cancer cells
   BJD12_11105
  Exosomal proteins of bladder cancer cells
   BJD12_11105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N DUF1481
Motif
Other DBs
NCBI-ProteinID: APP75699
Position
complement(2525697..2527667)
Genome map
AA seq 656 aa AA seqDB search
MQRRGPARRRIRPTHQTHAWQLPARVFPRGPGQCGIAPARTHGREGDASMNEQQTTPPCI
IVVFGARGDLTKRLVMPALYNLRRAGALGEEFAIVGMDHGDISERAWRSNMGQSMTQLLS
SRDAEFQTDEFDTDTWDWLRERMHYLRGDFTDLGAYQALDGVLEKLHKRYGTQGNVLFYL
ATAARFFEPVLLNLGEAGLVKQRESQGWRRVIVEKPFGHDLPSAKHLNATVAKVLHEDQV
FRIDHFLGKETVQNILAFRFANGLFEPVWNRDRIDHVQITAAETIGVEGRGRFYDPTGCL
RDMVPNHLFQLLAMIAMEPPAAFTTEAMHRRRAEVIEAVRPIKPEDVVRGQYASGAVNRS
AVPGYREEDTVPDDSDTETYVAMKLQVDTWRWAGVPFYLRTGKRLRERTTEIAIRFKPAP
LAPFRSTEVGGYGPDWLVLHIQPDEGISLQFDVKRPGAQVALAPVRMDFRYRDWFPKEYT
VGYERLLQDCMNGEAGLFQDAAMVEGAWRIVQPILDAWKQPASDFPNYAAGSAGPSAADA
LLAMNGGHAWRALTPGRKPPPRRPPEVRANAATPVKKAAKKATKKANKVPAKRASASSAN
PVRASEAASAKPAKKTPAKRVAKQAANTAKNVGKTAVSKVEPKTSVGKTAARKRRG
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
gtgcaacgacgtgggcctgctcgccgaagaatacgacccacgcaccaaacgcatgcttgg
caacttcccgcaagggtattcccacgtggccctggtcaatgcggcattgcgcctgcacgg
acgcatgggcgagaaggagacgcatccatgaatgagcaacaaaccacaccgccgtgcatc
atcgtggtgttcggcgcacgcggcgacctcaccaagcgcctggtgatgccggcgctatac
aacctgcgccgcgccggtgccttgggcgaagaattcgccattgtcggcatggaccatggc
gacatcagcgaacgtgcctggcgcagcaacatgggtcagtcgatgacgcagctgctgagc
agccgcgacgccgaattccagactgacgaattcgacaccgacacctgggactggctgcgc
gagcgcatgcattacctgcgcggcgactttaccgacctgggcgcgtatcaggcgctggat
ggggtgctggagaaactgcacaagcgctacggcacgcaaggcaatgtgctgttctatctc
gccaccgccgcacgctttttcgagccggtgctgctcaacctgggcgaagccggcctggtc
aagcagcgcgaaagccagggctggcgccgcgtcatcgtggaaaaaccgttcggccacgat
ctgcccagcgccaagcatctcaacgccaccgtggccaaggtgctgcacgaagatcaggtg
ttccgcatcgaccatttcctgggcaaggaaaccgtgcagaacattcttgcgtttcgtttc
gccaatggcttgttcgagccggtgtggaaccgcgaccgtatcgatcacgtgcagatcacc
gccgccgaaaccatcggcgtggaagggcgcgggcgcttttatgaccccaccggttgcctg
cgcgacatggtgcccaatcacctgttccagttgctggcgatgatcgcgatggagccgccg
gccgccttcaccaccgaggcgatgcatcgtcgccgtgccgaggtgatcgaggccgtgcgc
ccgatcaaacccgaagatgtggtgcgcggccagtatgcatccggcgcggtcaatcgcagc
gccgtgcccggctaccgcgaagaagacacggtgcccgacgattcggataccgaaacctat
gtggcgatgaagctgcaggtcgatacctggcgctgggccggcgtgccgttttatttgcgc
accggcaagcgtctgcgcgagcgcaccaccgagatcgccatccgcttcaagccggcgccg
ctggcaccgttccgcagtaccgaagtcggcggttacggccccgactggctggtgctgcac
atccagcccgacgaaggcatctcgctgcagttcgacgtcaagcgcccgggcgcgcaggtg
gcgctggcgccggtgcgcatggacttccgctaccgcgactggtttcccaaggaatacacc
gtgggctacgagcgcctgctgcaggactgcatgaacggcgaagccggcttgttccaggac
gcggcgatggtggaaggcgcctggcgcatcgtgcagccgatcctggacgcgtggaagcaa
ccagccagcgatttccccaactacgccgccggcagcgccggtccctcggctgccgacgca
ctgttggccatgaatggcggacacgcctggcgcgcgctcaccccgggccgcaagccgcca
ccgcgccgcccgccggaagtgcgcgccaacgcggcaacgccggtcaagaaagcggctaaa
aaagctacaaagaaagccaataaagtaccggccaagcgtgcatctgcctcttcggcaaat
cccgtgcgagcgtcagaagccgcgtctgccaagcctgcaaagaagacgccggccaagcga
gtggccaagcaggcggcgaacacggcgaagaacgtcggcaagactgcggtcagcaaggtc
gaacccaagacgtcggttggtaaaaccgcagcgcgcaaacggcgaggctga

DBGET integrated database retrieval system