KEGG   Xanthomonas vesicatoria: BJD12_12400Help
Entry
BJD12_12400       CDS       T04741                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
xve  Xanthomonas vesicatoria
Pathway
xve00480  Glutathione metabolism
xve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xve00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BJD12_12400
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xve02000]
    BJD12_12400
Enzymes [BR:xve01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BJD12_12400
Transporters [BR:xve02000]
 Other transporters
  Pores ion channels [TC:1]
   BJD12_12400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: APP75896
UniProt: F0BKS3
Position
2865938..2866558
Genome map
AA seq 206 aa AA seqDB search
MLDIYGKPTSINVRKVLWLCDELALDYRLHAYGSGFAPVDTPDFLALNPNGLVPVIGDGA
LVLWESNTICRYLAARCRREDLLPTAPAARALVEQWMDWQATELNTAWRYAFMATVRGSA
AHTDPHSIAASVSEWNRHMAILDAQLQRAGPYALGADFTLADIVLGLSTQRWFASPIERP
PLPAIAVYYALLQTRAGFQRHGCSAP
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgctggacatctacggaaagccgacatcgattaacgtgcgcaaggtgctgtggctgtgc
gacgagttggcgctggactaccgcttgcacgcctatggcagcgggttcgccccagtcgac
acacccgactttctggcgctcaacccgaacggcctggtaccggtgatcggcgatggcgcg
ctggtgttgtgggagtccaataccatctgccgttacctggctgcacgctgccggcgcgag
gatctgctgccgaccgcgccggccgcgcgtgccttggtcgaacagtggatggactggcag
gccaccgaactcaacactgcctggcgctacgcgttcatggccaccgtgcgtggcagcgcg
gcgcataccgacccgcacagcatcgccgccagcgtgtccgagtggaaccggcacatggcc
atcctggacgcgcaactgcagcgcgcggggccttacgcactgggcgcggacttcacattg
gccgatatcgtgctgggcctgtcgacgcagcgctggttcgccagtcccatcgagcgtcca
ccgctgccggcaattgccgtgtattacgcgctcttgcaaacgcgggcgggctttcagcgt
cacggctgcagtgcgccttaa

DBGET integrated database retrieval system