KEGG   Xanthomonas vesicatoria: BJD12_13635Help
Entry
BJD12_13635       CDS       T04741                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
xve  Xanthomonas vesicatoria
Pathway
xve00071  Fatty acid degradation
xve00072  Synthesis and degradation of ketone bodies
xve00280  Valine, leucine and isoleucine degradation
xve00310  Lysine degradation
xve00362  Benzoate degradation
xve00380  Tryptophan metabolism
xve00620  Pyruvate metabolism
xve00630  Glyoxylate and dicarboxylate metabolism
xve00640  Propanoate metabolism
xve00650  Butanoate metabolism
xve00900  Terpenoid backbone biosynthesis
xve01100  Metabolic pathways
xve01110  Biosynthesis of secondary metabolites
xve01120  Microbial metabolism in diverse environments
xve01130  Biosynthesis of antibiotics
xve01200  Carbon metabolism
xve01212  Fatty acid metabolism
xve02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BJD12_13635
   00630 Glyoxylate and dicarboxylate metabolism
    BJD12_13635
   00640 Propanoate metabolism
    BJD12_13635
   00650 Butanoate metabolism
    BJD12_13635
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BJD12_13635
   00072 Synthesis and degradation of ketone bodies
    BJD12_13635
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BJD12_13635
   00310 Lysine degradation
    BJD12_13635
   00380 Tryptophan metabolism
    BJD12_13635
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BJD12_13635
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BJD12_13635
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BJD12_13635
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xve04147]
    BJD12_13635
Enzymes [BR:xve01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BJD12_13635
Exosome [BR:xve04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BJD12_13635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: APP76093
Position
3165651..3166946
Genome map
AA seq 431 aa AA seqDB search
MPGQPMPAARPVAILGGVRIPFCRQNTAYADVGNLGMSVRTLGALVERFGLHGQQLGEVA
MGAVIKHSSDWNLAREAALSSGLSPLTPGITLQRACGTSLDSVITIANKIALGQIDSGIG
GGSDTTSEVPIVYGKKLRARLMAANRAKATGDKLKALLRGFKLSELKPEFPGVAEPRTGK
SMGDHCEDMAKEWNISRDSQDEWAVASHHKLAAAYERGFFDSLIAPFRGVSRDNILRADT
SLEKLATLRPAFDKTSGRGTLTAANSTPLTDGAAAVLLSSEAWALAHGHTPMAYLRDAQV
SAVDFVHGEGLLMAPTIAVPQMLARQGLTLQDFEIYEIHEAFAAQVLCTLRAWESEDYCR
NRLGLDAPLGRIDPDKINPLGSSLATGHPFAATGARVVATAAKQLEERGGGRALISICTA
GGMGVVAIVER
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgccaggtcaaccgatgcccgcagcccgtcccgtcgccattctgggcggcgttcgtatc
ccgttctgtcgtcagaacaccgcatacgcggacgtgggcaacttgggcatgtcggtgcgc
acgctgggcgcgctggtcgaacgcttcggcctgcatgggcagcaattgggcgaagtggcg
atgggcgcggtgatcaagcattcctcggactggaacctggcccgcgaggccgcgctgtcg
tcgggtctgtcgccgctgaccccgggcatcaccctgcagcgcgcctgcggcaccagcctg
gattcggtgatcaccatcgccaacaagatcgcgctgggccagatcgattccggcatcggc
ggcggctcggatactacctccgaggtgccgatcgtctacggcaagaaactgcgcgcgcgc
ctgatggccgccaatcgcgccaaggccaccggcgacaaactcaaggcgctgctccgcggc
ttcaagctgagcgagctcaagcccgaatttcctggcgtggccgagccgcgcaccggcaag
agcatgggcgaccactgcgaagacatggccaaggaatggaacatctcgcgcgattcgcag
gacgaatgggcggtggcctcgcaccataagctggccgcagcgtatgagcgcgggttcttc
gattcgctgatcgccccgttccgtggggtgtcgcgcgacaacatcctgcgcgcggacacc
tcgctggagaagctggcgaccctgcgcccggcgttcgacaagacttccggccgcggcacc
ttgaccgccgccaattccaccccgttgaccgatggcgctgccgcagtgctgctgtccagc
gaggcctgggcgctggcgcatggccacacgccgatggcctacctgcgcgatgcgcaggtg
tcggcggtggatttcgtgcatggcgagggcctgctgatggcgccgaccatcgcggtgccg
cagatgctggcacgccagggcctgaccctgcaggatttcgaaatctacgaaatccacgaa
gccttcgccgcgcaggtgctgtgcacgctgcgcgcctgggaaagcgaggactactgccgc
aatcgcctgggcctggacgcgccattgggccgcatcgacccggacaagatcaacccgctg
ggctcgtcgctggccaccggccacccattcgccgccaccggtgcgcgcgtggtggccacc
gccgccaagcagctggaagaacgaggcggcggccgcgcgctgatttcgatctgcaccgct
ggcggcatgggcgtggtggcgatcgtcgagcgctag

DBGET integrated database retrieval system