KEGG   Xanthomonas vesicatoria: BJD12_14865Help
Entry
BJD12_14865       CDS       T04741                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
xve  Xanthomonas vesicatoria
Pathway
xve00010  Glycolysis / Gluconeogenesis
xve00020  Citrate cycle (TCA cycle)
xve00620  Pyruvate metabolism
xve01100  Metabolic pathways
xve01110  Biosynthesis of secondary metabolites
xve01120  Microbial metabolism in diverse environments
xve01130  Biosynthesis of antibiotics
xve01200  Carbon metabolism
Module
xve_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:xve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BJD12_14865
   00020 Citrate cycle (TCA cycle)
    BJD12_14865
   00620 Pyruvate metabolism
    BJD12_14865
Enzymes [BR:xve01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BJD12_14865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: APP76294
UniProt: F0BKW6
Position
complement(3436592..3438085)
Genome map
AA seq 497 aa AA seqDB search
MSEAKNFHLPDLGEGLPDATIVEWFVKEGDSVRLDDPLVSMETAKAVVEVPSPFSGTVVK
LAGAAGDVIVTGAMLAQFALDASQPQRADGQDTGHGHGHGGSAQAATPSTGQSAAGPTER
VVASDNGGEIADADAHAHAAADAAGERDDAGTVVGAMQSSNTVQSEQAIAVGGVRTMPVV
RALARKLRVDLAQVRATGPDGTVTLADVKQAAAAGTAQAVRGAVLAPAGGAAAMSIGGDH
GQRPAPAGNRSPMQASNTTRTSEQARSTLSASGKPMRTQAPGTSVKGQPEQLKGVRRNMA
RVMADAHSKVVPTTLNDDADLHAWQPGNDVTVRLVRAIVRACQAVPALNAWFDGDALSRT
LHHQVDIGIAVDTEEGLFVPALRNADMLDAHGIREGVNRLRQQVETRSIAASELSGYTIS
LSNFGMFAGRYATPVVVPPCVAIAAAGRARYQLTPVMGGVETHKVMPLSLTFDHRAATGG
EAARFLRAMLDDLALAQ
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagcaaagaattttcatctgcccgacctgggcgaaggcctgcccgatgccacc
atcgtcgagtggttcgtcaaggaaggcgacagcgtgcgcctggacgacccgctggtgtcg
atggaaaccgccaaggcggtggttgaagtgccttcgccgttttccggcaccgtggtcaag
ctggccggtgcggccggtgatgtgatcgtcaccggcgcgatgctggcgcagttcgcactg
gatgcatcgcagccgcagcgcgccgacggccaggacaccggccatgggcatggccacggc
ggcagcgcacaggcggcaacgccgagcaccggacagagcgcggccggccccaccgaacgc
gtggtggcctccgataacggcggcgaaattgccgatgcggatgcgcacgcacatgcagct
gccgatgcggcaggtgagcgcgatgacgccggcaccgtggtcggtgcgatgcagagctcc
aacaccgtgcagagcgagcaggccatcgcggtcggtggcgtccgcaccatgccggtggtg
cgcgcgctcgcacgcaagttgcgcgtggatctggcccaggtgcgcgccaccggcccggac
ggcacggtgacgctagcggacgtgaagcaggcagctgcggcagggactgcgcaggcagtg
cgcggtgcagtgctcgcgccggccggcggcgcagctgcgatgagcatcggcggcgatcat
gggcagcgcccggccccggccggcaataggtcacccatgcaggcgagcaacacgacgcgc
acttccgaacaggcacgctctacgctgtcggccagcggcaagccgatgcgcacccaagcg
cccggcaccagcgtcaagggccaacccgaacagctcaagggcgtgcgtcgcaacatggcg
cgcgtcatggccgatgcgcacagcaaggtggtgccgaccacgctcaacgacgatgccgac
ctgcatgcctggcagcccggcaacgacgtcaccgtgcgcctggtgcgcgccatcgtacgt
gcctgccaggccgtgcccgcgctcaatgcctggttcgacggcgacgcgctcagccgcacc
ctgcaccaccaggtcgatatcggcattgcagtggataccgaagaaggcctgttcgtgccg
gcgctgcgcaatgccgacatgctggatgcgcacggcatccgcgaaggcgtcaaccggctg
cgccagcaggtggaaacccgcagcatcgccgcctccgaattgagcggctacaccatctcg
ctgtccaacttcggcatgttcgccggccgctacgccaccccggtggtggtgccgccgtgc
gtggccatcgcggctgccggccgtgcgcgttaccagctgaccccggtgatgggcggggtg
gaaacgcacaaggtcatgccgctgtcgctgaccttcgatcaccgcgccgccaccggcggg
gaagccgcgcgcttcctgcgcgcgatgctggacgacctggcgctggcgcagtga

DBGET integrated database retrieval system