KEGG   Xanthomonas vesicatoria: BJD12_16400Help
Entry
BJD12_16400       CDS       T04741                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
xve  Xanthomonas vesicatoria
Pathway
xve00520  Amino sugar and nucleotide sugar metabolism
xve01100  Metabolic pathways
xve01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BJD12_16400
Enzymes [BR:xve01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     BJD12_16400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: APP76541
UniProt: F0BI38
Position
3780266..3781420
Genome map
AA seq 384 aa AA seqDB search
MDASRTQALCNARVLTDDGLQDGLVVLLDGALIQAIVPADDVRVAQAYTRVDLGGATLLP
GFIDIQVNGGGGVLFNNARDPQALASIAAAHRRFGTTGLLPTLISDTAEVMAEAIEATRA
AIAQGVPGVLGIHLEGPYLSPARKGTHDAHKFRVPDAQEIAVDTSLENGVTLITLAPERV
PLDDIRAFVAGGAIVFAGHTAATYEQARDGIAAGVSGFTHLYNAMSQLAGREPNAVGAAL
EDPNVWCGVIVDGVHVHPASLRVALAAKPRGKLLLVTDAMPMVGSDSPSFDLYGETITAV
DGVVRNADGALAGSALDMATAVRNSVRWLGVDLAEAARMASTYPAQCIGLGERLGRIAPG
YQADLVLVDADVQVVNTWVAGQRD
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggatgcttcccgcactcaggcattgtgcaacgcgcgcgtactcaccgatgacggcctg
caggatggcctggtcgtgctgctggatggtgcgctgatccaggcgatcgtaccggccgac
gatgtgcgcgttgcgcaggcgtacacgcgcgtggacctgggcggtgccaccttgttgccc
ggcttcatcgacatccaggtcaacggcggcggcggggtgttgttcaacaacgcacgcgac
ccacaggcgctggccagcattgcggcagcgcatcgccgcttcggcaccaccggcctgctg
cccacgctgatcagcgacaccgcagaagtgatggccgaagcgatcgaggcaacgcgcgcc
gccatcgcgcaaggcgtgcccggcgtgctcggcatccatctggaaggcccgtacctgagc
cccgcacgcaagggcacgcacgacgcgcacaagttccgtgtgccggatgcgcaggaaatt
gccgtcgacacttcgctggaaaacggcgtcaccctgatcacgctcgcccccgagcgcgta
ccactggatgacatccgcgccttcgtggcgggcggggcgatcgtgttcgccggccacacc
gcagccacttacgagcaggcgcgcgatggcatcgccgcaggcgtcagcggctttacgcac
ctctacaacgccatgtcgcaactggccgggcgcgagcccaacgccgtgggcgccgcgctg
gaagatcccaatgtgtggtgtggcgtcatcgtcgatggcgtgcacgtgcatccggccagc
ctgcgcgtggccctggcggccaaaccgcgcggcaagctgctgctggtcaccgatgcgatg
ccgatggtcggtagcgacagccccagctttgacctgtacggcgaaaccatcactgcagtg
gatggggtggtgcgcaatgccgacggcgcgcttgccggctccgccctggacatggccacc
gccgtgcgcaacagcgtgcgctggttgggcgtggatcttgccgaagctgcacgcatggcg
tccacgtatccggcgcaatgcatcggcctgggcgagcgcctgggccgcatcgcacccggc
taccaggccgatctggtactggtggacgccgacgtgcaggtagtgaacacctgggtggcc
gggcagcgcgactga

DBGET integrated database retrieval system