KEGG   Xylanimicrobium sp. FW10M-9: ET471_03195Help
Entry
ET471_03195       CDS       T05815                                 

Definition
(GenBank) cysteine--tRNA ligase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
xya  Xylanimicrobium sp. FW10M-9
Pathway
xya00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:xya00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ET471_03195
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:xya01007]
    ET471_03195
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xya03016]
    ET471_03195
Enzymes [BR:xya01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     ET471_03195
Amino acid related enzymes [BR:xya01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   ET471_03195
Transfer RNA biogenesis [BR:xya03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    ET471_03195
 Prokaryotic Type
    ET471_03195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e DALR_2 tRNA-synt_1g tRNA-synt_1f tRNA-synt_1
Motif
Other DBs
NCBI-ProteinID: QAY69168
Position
complement(723824..725272)
Genome map
AA seq 482 aa AA seqDB search
MSLRLYDTATRTVSDFVPRTPGQVGIYVCGATVQSAPHVGHLRPSVAFDVLRRWLTRSGY
QVTLVRNVTDIDDKILAKADAAGVPWWAHAARYEREFTAAYDALGVLPPTYEPRATQHVT
QMVELMDRLVERGHAYTTGEGNVWFDVRSWPAYGELTRQRLDDLAPEPQSDDDVAAPGHA
KRDVHDFALWKAPKPGEPATASWPTPWGRGRPGWHLECSAMAQRYLGDEFDIHGGGLDLR
FPHHENEQAQSRAAGFGFAQRWMHSAWITQSGVKMSKSLGNGLLVSELFKAAAAPVVRYA
IVAVQYRSMLEWAPETLAEAATTWERLTGFVERATERVGAVDADEVRKTDLPDGFVAAMD
DDLNVPAALAVVHEHLRAGNTALAAAASPESDAAVRAELVALRGMLDVLGLDPADPQWAT
TDAAASSARDALDALVQGELAARAAARAAKDWAASDAIRDRLAAAGILVQDGPDGARWTL
TN
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
gtgagccttcgcctgtatgacaccgccacgcgcacggtgtccgacttcgtgccccggacc
cccggccaggtcggcatctacgtgtgcggcgcgaccgtgcagtcggccccgcacgtgggg
cacctgcgcccgtccgtcgcgttcgacgtgctgcgccgctggctcacccgcagcggctac
caggtcaccctggtgcgcaacgtcaccgacatcgacgacaagatcctcgccaaggccgac
gccgcgggcgtcccgtggtgggcgcacgccgcccgctacgagcgcgagttcaccgccgcg
tacgacgccctcggcgtcctgccgcccacctacgagccgcgcgccacccagcacgtcacc
cagatggtcgagctcatggaccgcctcgtcgagcgcgggcacgcctacaccaccggcgag
ggcaacgtctggttcgacgtgcgctcctggcccgcctacggcgagctcacccggcagcgc
ctcgacgacctcgcccccgagccgcagtccgacgacgacgtcgccgcacccggccacgcc
aagcgcgacgtgcacgacttcgccctgtggaaggcccccaagcccggagagccagccacc
gcctcctggcccaccccgtggggccgcggccgtcccggctggcacctcgagtgctccgcc
atggcccagcgctacctcggcgacgagttcgacatccacggcggcggcctcgacctgcgc
ttcccgcaccacgagaacgagcaggcccagtcccgcgccgccgggttcggattcgcccaa
cggtggatgcacagcgcctggatcacacagtccggcgtcaagatgagcaagtcgctcggc
aacgggctgctcgtctccgagctcttcaaggccgccgccgcacccgtcgtccgctacgcc
atcgtcgccgtccagtaccgctccatgctcgagtgggcgcccgagacgctcgccgaggcg
gccacgacgtgggagcggctcaccgggttcgtcgagcgcgccaccgagcgcgtcggcgcg
gtcgacgccgacgaggtccgcaagaccgacctccccgacggcttcgtcgccgcgatggac
gacgacctcaacgtgcccgcggcgctcgccgtcgtgcacgagcacctgcgcgccgggaac
acggcgctcgcggcggcggcgtcgcccgagtcggacgccgcggtgcgcgccgagctggtc
gcgctgcgcggcatgctcgacgtgctgggcctcgacccggccgacccgcagtgggccacg
accgacgccgcggcgtcgtcggcgcgcgacgccctcgacgcgctcgtgcagggcgagctg
gcggcgcgtgccgccgcgcgcgccgcgaaggactgggccgcgagcgacgcgatccgcgac
cgcctggccgcggcgggcatcctggtccaggacgggcccgacggcgcccgctggacgctg
acgaactga

DBGET integrated database retrieval system