KEGG   Xylanimicrobium sp. FW10M-9: ET471_03930Help
Entry
ET471_03930       CDS       T05815                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
xya  Xylanimicrobium sp. FW10M-9
Pathway
xya00020  Citrate cycle (TCA cycle)
xya00480  Glutathione metabolism
xya01100  Metabolic pathways
xya01110  Biosynthesis of secondary metabolites
xya01120  Microbial metabolism in diverse environments
xya01200  Carbon metabolism
xya01210  2-Oxocarboxylic acid metabolism
xya01230  Biosynthesis of amino acids
Module
xya_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xya_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:xya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ET471_03930
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ET471_03930
Enzymes [BR:xya01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     ET471_03930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH CBM39
Motif
Other DBs
NCBI-ProteinID: QAY69291
UniProt: A0A4V0YFY1
Position
869378..871597
Genome map
AA seq 739 aa AA seqDB search
MAGPSTIIYTHTDEAPLLATYSFLPIVQAFAGQAGVELETRDISVAARILAQFPERLTPE
QQVPDALAELGRLAEEPTANIIKLPNVSASVPQLKAAIAELRAQGFDVPDYPEAPATDEE
RDVRARYDRVKGSAVNPVLRQGNSDRRAPGSVKAYAKAHPHRMGAWSPTSQTNVATMTEG
DFFHNEKSVVIPADDTLTIRLVADDGTVSVLKSGLSVLAGEVVDGTFLSVRALRAFLAAQ
ISRAQEEGVLFSAHLKATMMKVSDPIIFGHVVETFLPAVFEQFGDSLRAAGVSANDGLGA
LLAATESMTDGEAVRQAVADGLAAGPALAMVNSDKGITNLHVPSDVIIDASMPAMIRGGG
KMWGPDGKEHDTLAVIPDSSYAGVYQAAIDDCRAHGALDPATIGTVPNVGLMAKAAEEYG
SHDKTFEIPVAGRVEVVDGTGEVLFAHDVEAGDIWRACQTKDAPIRDWVALAVRRARLSG
TPAVFWLDAHRAHDLNLIGKLEQYLPEHDTDGLEIHVMAPAEATAFSFARMRAGLDTISV
TGNVLRDYNTDLFPILEVGTSAKMLSIVPLMNGGGLFETGAGGSAPKHVQQLVEENYLRW
DSLGEFFALAASFEHLAQTTSNARAQLLADTLDRATGTFLDQDRSPGRKLGTIDNRGSHF
YLALYWAQELAAQTTDAELAAAFGPLAAALAASEAQIVEELLAVQGAPAEIGGYYRPDPE
LTSAVMRPSATFNGALASL
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atggccggtccgagcacgatcatctacacccacaccgacgaggcaccgctgctggcgacg
tactcgttcctgccgatcgtccaggccttcgcgggccaggccggcgtcgagctcgagacg
cgcgacatctccgtcgcggcgcgcatcctcgcgcagttcccggagcgcctgaccccggag
cagcaggtcccggacgcgctcgccgagctcgggcgcctcgccgaggagcccacggccaac
atcatcaagctccccaacgtctccgcgtcggtgccgcagctcaaggccgcgatcgccgag
ctccgggcgcagggcttcgacgtgcccgactaccccgaggcgccggccaccgacgaggag
cgcgacgtgcgcgcccgctacgaccgcgtcaagggctcggccgtcaaccccgtgctccgc
cagggcaactccgaccgccgcgcccccggctcggtcaaggcgtacgccaaggcgcacccg
caccgcatgggcgcctggtcgccgacgtcgcagaccaacgtcgcgaccatgaccgagggc
gacttcttccacaacgagaagtcggtcgtcatccccgccgacgacaccctgacgatccgc
ctcgtcgccgacgacggcacggtctccgtgctcaagagcgggctctccgtgctcgccggc
gaggtcgtggacggcacgttcctgtcggtgcgcgcgctgcgcgcgttcctcgccgcgcag
atctcgcgcgcgcaggaggagggcgtgctcttctccgcccacctcaaggccacgatgatg
aaggtctccgacccgatcatcttcgggcacgtggtcgagacgttcctgcccgccgtgttc
gagcagttcggcgactcgctgcgtgccgcgggcgtctccgccaacgacggcctgggcgcc
ctgctcgccgcgacggagtcgatgacggacggcgaggcggtccgccaggcggtggccgac
gggctcgccgccggcccggccctcgcgatggtcaactcggacaagggcatcaccaacctg
cacgtcccgtcggacgtcatcatcgacgcctccatgccggcgatgatccgcggcggcggc
aagatgtggggcccggacggcaaggagcacgacacgctcgccgtcatccccgactcgtcg
tacgcgggcgtctaccaggcggcgatcgacgactgccgtgcgcacggcgcactcgacccg
gccaccatcggcaccgtgccgaacgtcggtctcatggccaaggcggccgaggagtacggc
tcgcacgacaagaccttcgagatccccgtggcgggccgcgtcgaggtcgtcgacggcacc
ggcgaggtgctcttcgcgcacgacgtcgaggccggcgacatctggcgcgcctgccagacc
aaggacgccccgatccgcgactgggtcgccctggccgtgcgccgcgcccgcctctcgggc
acccccgcggtgttctggctggacgcgcaccgcgcgcacgacctcaacctcatcggcaag
ctcgagcagtacctgccggagcacgacacggacggcctggagatccacgtcatggccccc
gccgaggcgaccgcgttctccttcgcgcgcatgcgcgcgggcctcgacaccatctcggtg
acgggcaacgtgctgcgcgactacaacaccgacctgttcccgatcctcgaggtgggcacg
tcggccaagatgctctcgatcgtgccgctcatgaacggcggcggcctgttcgagacgggc
gccggcggctccgccccgaagcacgtgcagcagctcgtcgaggagaactacctgcgctgg
gactcgctcggcgagttcttcgcgctcgcggcgtcgttcgagcacctcgcgcagacgacg
tcgaacgcccgcgcccagctcctcgccgacacgctcgaccgcgcgaccggcacgttcctc
gaccaggaccgctcgccgggccgcaagctcggcacgatcgacaaccgtggctcgcacttc
tacctggccctctactgggcccaggagctcgccgcgcagacgacggacgcggagctcgcg
gccgccttcggcccgctggccgccgcgctggcggcgtccgaggcgcagatcgtcgaggag
ctcctcgcggtccagggcgccccggccgagatcggcggctactaccgcccggacccggag
ctgacgagcgccgtcatgcgcccgagcgccacgttcaacggggccctcgcgtccctctga

DBGET integrated database retrieval system