KEGG   Xylanimicrobium sp. FW10M-9: ET471_05790Help
Entry
ET471_05790       CDS       T05815                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
xya  Xylanimicrobium sp. FW10M-9
Pathway
xya00260  Glycine, serine and threonine metabolism
xya01100  Metabolic pathways
xya01110  Biosynthesis of secondary metabolites
xya01120  Microbial metabolism in diverse environments
xya01130  Biosynthesis of antibiotics
xya01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xya00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ET471_05790
Enzymes [BR:xya01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     ET471_05790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: QAY71755
UniProt: A0A4P6F888
Position
complement(1278550..1279638)
Genome map
AA seq 362 aa AA seqDB search
MPPFGSDNYAPTHPEVLAAIAAANEGYAVAYGDDAWTARLADRVRDVFGAGATAFPVLNG
TGANVVSLMATTSRWAGVVASDVAHAHTDENGAPERVGGLKLLTRPAVDGKIEPLDVAAW
FGELGDVHRAQPQVLTLTQATELGTVYDVEELTALVEVAHGMGLAVHVDGSRLANAAAHL
GVGLRALTTDVGVDVVSLGAAKNGGLLGEAVVVLGPDDAPTPGAADARRAAAAAVPFLRK
STMQLASKARYVSAQLLAMLDGDEPLWHRNASAANAAAQRLRAGVEALGGDVVRVTRPTQ
SNAVFATLPRAAADRLRERTRFYDWADGETLDRVEVRWMCSWATTPADVDAFLAALRAAT
AA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
ctgcctcccttcggctccgacaactacgcccccacgcaccccgaggtcctcgccgccatc
gccgcggcgaacgagggctacgccgtcgcctacggcgacgacgcgtggacggcccgcctc
gccgaccgcgtgcgtgacgtcttcggcgccggagccaccgcgttccccgtgctcaacggc
acgggcgcgaacgtcgtcagcctcatggcgacgacgtcgcgctgggcgggcgtcgtcgcc
tccgacgtcgcgcacgcgcacacggacgagaacggggcgccggagcgcgtcggcggcctc
aagctgctcacgcgcccggcggtggacggcaagatcgagccgctcgacgtcgcggcgtgg
ttcggggagctcggcgacgtgcaccgcgcgcagccgcaggtgctcacgctcacgcaggcc
acggagctcggcacggtctacgacgtcgaggagctcaccgccctggtcgaggtcgcgcac
ggcatgggcctggccgtccacgtggacggctcgcggctcgccaacgccgccgcgcacctc
ggcgtcgggctgcgcgcgctcaccaccgacgtcggcgtcgacgtcgtctcgctcggcgcc
gcgaagaacggcggcctgctcggcgaggcggtcgtcgtcctggggcccgacgacgccccg
acgcccggcgcggccgacgcccggcgggcggccgccgcggcggtgccgttcctgcgcaag
tcgacgatgcagctcgcctccaaggcccggtacgtctccgcgcagctgctcgcgatgctg
gacggcgacgagccgctgtggcaccgcaacgcgtccgccgcgaacgccgcggcgcagcgc
ctgcgcgcgggcgtcgaggccctcggcggcgacgtcgtccgcgtcacgcggcccacgcag
tccaacgccgtcttcgcgacgctcccccgcgccgccgccgaccgcctgcgcgagcggacg
cgcttctacgactgggccgacggcgagaccctggaccgcgtcgaggtccgctggatgtgc
agctgggcgacgacgccggccgacgtggacgcgttcctggcggcgctgcgggcagcgacc
gccgcctga

DBGET integrated database retrieval system