KEGG   Xylanimicrobium sp. FW10M-9: ET471_08800Help
Entry
ET471_08800       CDS       T05815                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
xya  Xylanimicrobium sp. FW10M-9
Pathway
xya00480  Glutathione metabolism
xya00590  Arachidonic acid metabolism
xya01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xya00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    ET471_08800
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ET471_08800
Enzymes [BR:xya01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ET471_08800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: QAY70127
UniProt: A0A4P6F9S5
Position
complement(1896447..1896929)
Genome map
AA seq 160 aa AA seqDB search
MDIYDIPFQRMDGTTTTLADHRDDVVLVVNVASRCGLTPQYEALETLQKTYADRGFTVIG
FPSNQFLQELGSNEAIAEFCSTTYGVTFPVMDRVRVNGRRAAPLYEALKQTPDAGGHDGR
IRWNFEKFLVLPGGDVRRYDPKTVPDDPQIVETIEGALPR
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggacatctacgacatcccgttccagcgcatggacgggacgacgacgacgctcgcggac
caccgcgacgacgtcgtcctcgtggtcaacgtcgcctcgcggtgcggcctgacgccgcag
tacgaggccctggagacgctgcagaagacgtacgccgaccgcgggttcaccgtcatcggc
ttcccctcgaaccagttcctccaggagctcggctccaacgaggcgatcgcggagttctgc
tcgacgacgtacggcgtgaccttccccgtcatggaccgcgtccgcgtcaacggccgccgc
gccgcgccgctgtacgaggcgctcaagcagacccccgacgccggcgggcacgacgggcgc
atccggtggaacttcgagaagttcctggtgctgccgggcggcgacgtgcgccgctacgac
ccgaagacggtgccggacgacccccagatcgtggagacgatcgagggcgcgctgccgcgc
tga

DBGET integrated database retrieval system