KEGG   Xylanimicrobium sp. FW10M-9: ET471_13495Help
Entry
ET471_13495       CDS       T05815                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
xya  Xylanimicrobium sp. FW10M-9
Pathway
xya00030  Pentose phosphate pathway
xya00480  Glutathione metabolism
xya01100  Metabolic pathways
xya01110  Biosynthesis of secondary metabolites
xya01120  Microbial metabolism in diverse environments
xya01130  Biosynthesis of antibiotics
xya01200  Carbon metabolism
Module
xya_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
xya_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:xya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ET471_13495
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ET471_13495
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xya04147]
    ET471_13495
Enzymes [BR:xya01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     ET471_13495
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     ET471_13495
Exosome [BR:xya04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   ET471_13495
  Exosomal proteins of colorectal cancer cells
   ET471_13495
  Exosomal proteins of bladder cancer cells
   ET471_13495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N Hypoth_Ymh
Motif
Other DBs
NCBI-ProteinID: QAY70913
UniProt: A0A4P6F7R9
Position
complement(2916791..2918332)
Genome map
AA seq 513 aa AA seqDB search
MRPAKITAEHNPLRDPRDLRLPRIAGPSGLVIFGVTGDLSRKKLMPAVYDLANRGLLPPG
FALTGFARRDWADEDFAQVVHDAVKQYARTPFREATWRQLSEGIRFVQGAFDDDEAFAEL
RRTVEKLDAERGTGGNHAFYLSIPPSAFPTVVQQLQEHGLSTPQEGAWRRVVIEKPFGHD
LESAKELDAVVSEVFDQESVFRIDHYLGKETVQNLLALRFANQMFEPIWNNNYVDHVQIT
MAEDIGIGGRAGYYDGIGAARDVIQNHLLQLLALVAMEEPVNFEANALRAEKIKALSSVR
IPHDLGRHTARGQYAAAWQGGEKVVGFLEEEGFNPESTTETFAAVRLDIDNRRWAGVPFY
LRTGKRLGRRVTEVAVVFKKAPHLPFESSLTSELGNNALVIRVQPDEGVTMRFGAKVPGT
AMEVRDVTMDFGYGHAFTESSPEAYERLILDVLLGDPPLFPTREEVELSWKILDPITAYW
AKQGRPEQYPAGTWGPASADAMMARDGRAWRRP
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
gtgaggcccgccaagatcaccgcggagcacaacccgctgcgcgacccccgcgacctgcgc
ctgccgcgcatcgcgggcccgtccgggctggtcatcttcggcgtgacgggcgacctgtcg
cgcaagaagctcatgccggcggtgtacgacctggccaaccgcggcctgctgcccccgggc
ttcgcgctgacgggcttcgcgcgccgcgactgggcggacgaggacttcgcgcaggtggtg
cacgacgccgtcaagcagtacgcgcgcaccccgttccgcgaggccacctggcgccagctc
tccgagggcatccggttcgtccagggcgcgttcgacgacgacgaggcgttcgccgagctg
cgccgcacggtcgagaagctcgacgcggagcggggcacgggcggcaaccacgccttctac
ctgtcgatcccgccgagcgcgttccccaccgtggtccagcagctccaggagcacggcctc
tcgacgccgcaggagggcgcctggcgccgcgtcgtcatcgagaagccgttcggtcacgac
ctggagtcggccaaggagctcgacgccgtcgtgtccgaggtgttcgaccaggagtcggtg
ttccgcatcgaccactacctgggcaaggagacggtccagaacctgctggcgctgcgcttc
gcgaaccagatgttcgagccgatctggaacaacaactacgtcgaccacgtgcagatcacg
atggccgaggacatcggcatcggcggccgcgccggctactacgacggcatcggcgctgcc
cgcgacgtcatccagaaccacctgctccagctcctcgccctcgtggcgatggaggagccg
gtgaacttcgaggcgaacgcgctgcgcgccgagaagatcaaggcgctgtcctccgtccgc
atcccccacgacctgggccgccacaccgcgcgcggccagtacgcggccgcgtggcagggc
ggcgagaaggtcgtcggcttcctcgaagaggaggggttcaaccccgagtccacgacggag
acgttcgccgccgtccgcctcgacatcgacaaccgccgctgggcgggcgtgccgttctac
ctgcgcacgggcaagcgcctgggccgccgcgtcaccgaggtggccgtcgtgttcaagaag
gcgccgcacctgccgttcgagtcgtcgctgacgtccgagctcggcaacaacgcgctggtc
atccgcgtgcagcccgacgagggcgtcacgatgcggttcggcgccaaggtgccgggcacc
gcgatggaggtccgcgacgtcacgatggacttcggctacggccacgccttcaccgagtcc
tcgcccgaggcctacgagcgcctcatcctcgacgtgctgctgggcgacccgccgctcttc
ccgacgcgcgaggaggtcgagctctcctggaagatcctcgacccgatcacggcgtactgg
gccaagcagggccgtcccgagcagtaccccgccggcacctggggccccgcctcggccgac
gcgatgatggcccgtgacggccgtgcctggaggaggccctga

DBGET integrated database retrieval system