KEGG   Xylanimicrobium sp. FW10M-9: ET471_13495
Entry
ET471_13495       CDS       T05815                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
xya  Xylanimicrobium sp. FW10M-9
Pathway
xya00030  Pentose phosphate pathway
xya00480  Glutathione metabolism
xya01100  Metabolic pathways
xya01110  Biosynthesis of secondary metabolites
xya01120  Microbial metabolism in diverse environments
xya01200  Carbon metabolism
Module
xya_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
xya_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:xya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ET471_13495
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ET471_13495
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xya04147]
    ET471_13495
Enzymes [BR:xya01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     ET471_13495
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     ET471_13495
Exosome [BR:xya04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   ET471_13495
  Exosomal proteins of colorectal cancer cells
   ET471_13495
  Exosomal proteins of bladder cancer cells
   ET471_13495
SSDB
Motif
Pfam: G6PD_C G6PD_N
Other DBs
NCBI-ProteinID: QAY70913
UniProt: A0A4P6F7R9
Position
complement(2916791..2918332)
AA seq 513 aa
MRPAKITAEHNPLRDPRDLRLPRIAGPSGLVIFGVTGDLSRKKLMPAVYDLANRGLLPPG
FALTGFARRDWADEDFAQVVHDAVKQYARTPFREATWRQLSEGIRFVQGAFDDDEAFAEL
RRTVEKLDAERGTGGNHAFYLSIPPSAFPTVVQQLQEHGLSTPQEGAWRRVVIEKPFGHD
LESAKELDAVVSEVFDQESVFRIDHYLGKETVQNLLALRFANQMFEPIWNNNYVDHVQIT
MAEDIGIGGRAGYYDGIGAARDVIQNHLLQLLALVAMEEPVNFEANALRAEKIKALSSVR
IPHDLGRHTARGQYAAAWQGGEKVVGFLEEEGFNPESTTETFAAVRLDIDNRRWAGVPFY
LRTGKRLGRRVTEVAVVFKKAPHLPFESSLTSELGNNALVIRVQPDEGVTMRFGAKVPGT
AMEVRDVTMDFGYGHAFTESSPEAYERLILDVLLGDPPLFPTREEVELSWKILDPITAYW
AKQGRPEQYPAGTWGPASADAMMARDGRAWRRP
NT seq 1542 nt   +upstreamnt  +downstreamnt
gtgaggcccgccaagatcaccgcggagcacaacccgctgcgcgacccccgcgacctgcgc
ctgccgcgcatcgcgggcccgtccgggctggtcatcttcggcgtgacgggcgacctgtcg
cgcaagaagctcatgccggcggtgtacgacctggccaaccgcggcctgctgcccccgggc
ttcgcgctgacgggcttcgcgcgccgcgactgggcggacgaggacttcgcgcaggtggtg
cacgacgccgtcaagcagtacgcgcgcaccccgttccgcgaggccacctggcgccagctc
tccgagggcatccggttcgtccagggcgcgttcgacgacgacgaggcgttcgccgagctg
cgccgcacggtcgagaagctcgacgcggagcggggcacgggcggcaaccacgccttctac
ctgtcgatcccgccgagcgcgttccccaccgtggtccagcagctccaggagcacggcctc
tcgacgccgcaggagggcgcctggcgccgcgtcgtcatcgagaagccgttcggtcacgac
ctggagtcggccaaggagctcgacgccgtcgtgtccgaggtgttcgaccaggagtcggtg
ttccgcatcgaccactacctgggcaaggagacggtccagaacctgctggcgctgcgcttc
gcgaaccagatgttcgagccgatctggaacaacaactacgtcgaccacgtgcagatcacg
atggccgaggacatcggcatcggcggccgcgccggctactacgacggcatcggcgctgcc
cgcgacgtcatccagaaccacctgctccagctcctcgccctcgtggcgatggaggagccg
gtgaacttcgaggcgaacgcgctgcgcgccgagaagatcaaggcgctgtcctccgtccgc
atcccccacgacctgggccgccacaccgcgcgcggccagtacgcggccgcgtggcagggc
ggcgagaaggtcgtcggcttcctcgaagaggaggggttcaaccccgagtccacgacggag
acgttcgccgccgtccgcctcgacatcgacaaccgccgctgggcgggcgtgccgttctac
ctgcgcacgggcaagcgcctgggccgccgcgtcaccgaggtggccgtcgtgttcaagaag
gcgccgcacctgccgttcgagtcgtcgctgacgtccgagctcggcaacaacgcgctggtc
atccgcgtgcagcccgacgagggcgtcacgatgcggttcggcgccaaggtgccgggcacc
gcgatggaggtccgcgacgtcacgatggacttcggctacggccacgccttcaccgagtcc
tcgcccgaggcctacgagcgcctcatcctcgacgtgctgctgggcgacccgccgctcttc
ccgacgcgcgaggaggtcgagctctcctggaagatcctcgacccgatcacggcgtactgg
gccaagcagggccgtcccgagcagtaccccgccggcacctggggccccgcctcggccgac
gcgatgatggcccgtgacggccgtgcctggaggaggccctga

DBGET integrated database retrieval system