KEGG   Xylanibacterium sp. 2JSPR-7: ET495_13480Help
Entry
ET495_13480       CDS       T05814                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
xyl  Xylanibacterium sp. 2JSPR-7
Pathway
xyl00260  Glycine, serine and threonine metabolism
xyl01100  Metabolic pathways
xyl01110  Biosynthesis of secondary metabolites
xyl01120  Microbial metabolism in diverse environments
xyl01130  Biosynthesis of antibiotics
xyl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xyl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ET495_13480
Enzymes [BR:xyl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     ET495_13480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: QAY64064
UniProt: A0A4P6EN08
Position
complement(2973883..2975001)
Genome map
AA seq 372 aa AA seqDB search
MLELTAYAGPVLPPFASDNYAPAHPEVVAAIAAANDGYAVAYGDDPWSARLGERVREVFG
TGATAFPVLNGTGANVVALMATTSRWAGVVASDVAHIHTDENGAPERVGGLKLLTRPTTH
GRLTVADVEAWADELGDVHRAQPAVLTLTQATELGTVYRPDDVRALTEAAHALGLAVHVD
GSRLANAAAFLGTGLRELTTDVGVDIVSLGAAKNGGLLGEAVVVLGPDDAPTPGAAAARR
AAAEAVPYLRKSTMQLASKTRFVSAQLLTMLDDDAGSPLWRRNATAANAAAARLRRGVEA
LGGDVRVTRPTEANAVFATLPRGAADRLRERSRFYDWADGESPGRVEVRWMCSWATTDRD
VDGFLVALAESL
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaactcaccgcctacgctggccccgtgctgcctccgttcgcgtctgacaactac
gctcctgcgcatcccgaggtggtcgccgcgatcgcggcggccaacgacgggtacgccgtc
gcctacggggacgacccctggagcgcacggctcggtgagcgggtccgggaggtgttcggc
acgggcgcgaccgcgttcccggtgctcaacggcacgggggccaacgtcgtggcgctcatg
gcgacgacgtcgcgctgggccggggtggtcgcctccgacgtcgcgcacatccacaccgac
gagaacggcgcccccgaacgcgtcggcggcctcaagctgctgacccgccccaccacgcac
ggccgcctcacggtcgccgacgtcgaggcgtgggccgacgagctcggcgacgtccaccgc
gcgcaacccgccgtgctcacgctcacgcaggccaccgagctcggcaccgtgtaccggccc
gacgacgtgcgcgcgctcaccgaggccgcgcacgccctgggcctcgccgtgcacgtcgac
gggtcgcgcctggccaatgcggcggcgttcctcggcaccgggctgcgggagctgaccacc
gacgtcggcgtcgacatcgtctcgctgggcgccgcgaagaacggcggcctgctgggcgag
gccgtcgtcgtgctgggccccgacgacgcgcccacccccggcgcggccgccgcacgccgg
gcggcggccgaggccgtgccctacctgcgcaagtcgaccatgcagctcgcgtcgaagacc
cggttcgtcagcgcacagctcctgacgatgctcgacgacgacgccgggagccccctgtgg
cgccgcaacgcgacggccgcgaacgccgccgcggcccgcctgcgcaggggcgtcgaggcg
ctcggaggcgacgtgcgcgtcacgcggcccaccgaggccaacgccgtcttcgccacgctc
ccccgcggcgcggccgaccggctgcgcgagcggtcccggttctacgactgggccgacggc
gagtcccccggccgcgtcgaggtgcgctggatgtgctcgtgggccaccaccgaccgggac
gtggacgggttcctcgtcgcgctcgcggagtcgctctga

DBGET integrated database retrieval system