KEGG   Yersinia aleksiciae: ACZ76_04715Help
Entry
ACZ76_04715       CDS       T03994                                 

Definition
(GenBank) 23S rRNA methyltransferase
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
yak  Yersinia aleksiciae
Brite
KEGG Orthology (KO) [BR:yak00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:yak03009]
    ACZ76_04715
Enzymes [BR:yak01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     ACZ76_04715
Ribosome biogenesis [BR:yak03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    ACZ76_04715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ Spt5-NGN Endonuc-BsobI DUF5645
Motif
Other DBs
NCBI-ProteinID: AKP32896
Position
complement(994923..996029)
Genome map
AA seq 368 aa AA seqDB search
MNNKIALYCRSGFEKECAAEITAKAAELEIFGFARVKDNSGYVLFECYQLEDADRLIREV
PFRELIFARQMMVVGELLKDLPPEDRVSPIVGMLTGVIEKAGELRVEVPDTNESKELLKF
CRKLTVPLRSAMRAQKILSARENAHRPVVHVFFIASGCCYVGYSYSNNNSPFYMGIPRLK
FPSDAPSRSTLKLEEAFHMFIPADEWEERLASGMHAVDLGACPGGWTYQLVQRSMMIQAV
DNGSMAQSLMDTGQVTHHRVDGFKYEPTRSNIYWLVCDMVEKPAKVTELIIKWLVNGWCR
EAIFNLKLPMKKRFEIVLENLEMMDEQLKENGINAHIQCKQLYHDREEVTVHVRRIWSGA
PGRRDERE
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaataataaaattgctttatattgccgctccggctttgagaaagagtgtgcggcagaa
attaccgcgaaagcggctgagctcgaaatttttggttttgcgcgagtcaaagataacagc
ggctatgtgctgtttgagtgttatcagttggaagatgctgatcgcttgatccgtgaagta
cccttccgtgagctgatttttgcccgtcaaatgatggtggtgggggagttgttgaaagac
ttaccaccggaagatcgtgtgtcaccgattgtgggcatgttgaccggtgttatcgaaaaa
gcgggtgagctgcgggttgaagtccctgacactaatgaaagcaaagagttactgaagttt
tgtcgcaagctgacagtccctttgcgtagcgccatgcgcgcacagaaaattctgtccgcc
cgtgaaaatgctcatcgtccagtggtgcatgtgttctttatcgcgtcaggctgttgttat
gtcggctactcatatagcaataacaactctccattctatatggggatcccacgtcttaaa
ttcccgtctgatgccccaagccgctcaaccttaaaactggaagaagctttccatatgttt
atccctgcggatgaatgggaagagcgcttagccagtggtatgcatgctgttgatttaggc
gcatgccccggtggttggacctatcagttggtacaacgcagcatgatgattcaggccgtt
gataacggttctatggcacaaagcctgatggatactgggcaggtgacacatcaccgtgtt
gatggttttaaatatgagccaacgcgcagcaatatctactggttagtgtgcgatatggta
gagaaaccggccaaggtaactgaacttatcatcaaatggctggtaaatggttggtgccgt
gaggcgattttcaacctgaaattaccgatgaaaaaacggtttgaaatcgttttggaaaac
ttggaaatgatggatgagcaactgaaagaaaatgggatcaatgcccatattcagtgcaag
cagctctaccatgaccgtgaggaagtgacggtgcatgtgcgtcggatttggtctggggcg
ccgggtcgccgtgatgagcgcgaataa

DBGET integrated database retrieval system