KEGG   Yersinia aleksiciae: ACZ76_08635Help
Entry
ACZ76_08635       CDS       T03994                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
yak  Yersinia aleksiciae
Pathway
yak00051  Fructose and mannose metabolism
yak01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ACZ76_08635
Enzymes [BR:yak01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     ACZ76_08635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh ApbA 3HCDH_N UDPG_MGDP_dh_N SpoU_sub_bind
Motif
Other DBs
NCBI-ProteinID: AKP33601
Position
1890094..1891257
Genome map
AA seq 387 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAGAQLTFADVNQPLLDELNKRKSYQVNVVGEQARVEEV
NNVSAVNSGSPEVVALIADADIVTTAVGPQILARIAGTVAQGLIARHQQGNTRPLNIIAC
ENMVRGTSQLKQHVFAALPESEQAWVEQHVGFVDSAVDRIVPPSEAGSTDILAVTVETFS
EWIVDGTQFKGQPPKIAGMELTDNLMAFVERKLFTLNTGHAITAYLGQLAGHQTIRDAIL
DPAVRQTVKGAMEESGAVLIKRYAFDPQKHAAYINKILSRFENPYLHDDVERVGRQPLRK
LSAGDRLIKPLLGTLEYQLPHDNLVTGIAAAMSYRSEQDPQAQELVELLAKLGPKAALAQ
ISALPADSEVVEQAVNVYNAMQDKRAH
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggcgcaggtaacattggccgaggctttatcggtaaacttctt
gctgatgctggcgcgcaactgaccttcgctgatgttaaccagccgctgctggatgagctg
aataagcgcaaaagttatcaggtcaacgtagttggcgagcaggcccgagtcgaggaagtc
aacaatgtcagcgcagtcaacagtggtagcccagaagtggtggcactgattgccgacgct
gatattgtcaccaccgccgttggcccgcaaattttggcccgcatcgccgggacggtggca
cagggtttgattgcccgccatcaacaaggtaatacccgcccgctgaatattattgcctgc
gaaaatatggtgcgtggcaccagtcagttaaaacaacatgtttttgccgccctgccggaa
agtgagcaggcctgggttgagcaacatgtcggtttcgtcgactctgcggttgaccgcatt
gtgccgccatcagaagcaggcagcaccgatattctggccgtaacagttgagacgtttagc
gagtggattgtcgacggcacccagtttaaaggacaaccaccaaaaatcgccggtatggag
ttgactgacaatctgatggcatttgtggagcgtaagctcttcaccctcaataccggtcat
gccattaccgcctatttgggccaacttgcgggtcaccagaccatccgtgatgcgattctg
gatcctgcggtgcgccagacagtgaaaggcgcgatggaagagagcggcgcggtactgatt
aagcgctatgcatttgatccacaaaaacatgccgcttatatcaacaaaattctctcccgt
tttgaaaacccttacctgcatgacgatgttgagcgcgttggccgtcagccactgcgtaaa
ttgagtgccggtgatcggttgatcaaaccgctgctgggaacgctggagtaccaattgccg
cacgataatctggtcaccggcatcgccgctgccatgagctatcgcagtgagcaggacccg
caagcacaggaattagttgagttactggcgaaattagggccgaaagctgcgttagcgcaa
atttcagcgttacctgcagatagcgaggttgtcgaacaggcggtgaatgtgtataacgcc
atgcaggataagcgggcgcactga

DBGET integrated database retrieval system