KEGG   Yersinia aleksiciae: ACZ76_15255Help
Entry
ACZ76_15255       CDS       T03994                                 

Definition
(GenBank) succinyl-CoA synthetase subunit alpha
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
yak  Yersinia aleksiciae
Pathway
yak00020  Citrate cycle (TCA cycle)
yak00640  Propanoate metabolism
yak00660  C5-Branched dibasic acid metabolism
yak01100  Metabolic pathways
yak01110  Biosynthesis of secondary metabolites
yak01120  Microbial metabolism in diverse environments
yak01130  Biosynthesis of antibiotics
yak01200  Carbon metabolism
Module
yak_M00009  Citrate cycle (TCA cycle, Krebs cycle)
yak_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:yak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ACZ76_15255
   00640 Propanoate metabolism
    ACZ76_15255
   00660 C5-Branched dibasic acid metabolism
    ACZ76_15255
Enzymes [BR:yak01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     ACZ76_15255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: AKP34779
Position
3399523..3400395
Genome map
AA seq 290 aa AA seqDB search
MSILINKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTQHLGLPVFNTVREA
VETTGATASVIYVPAPFCKDSILEAIDAGIKLIICITEGIPTLDMLVVKVRLEQSDARMI
GPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDIGFGQSTCVGIGG
DPIPGSNFIDILKLFQEDPQTEVIVMIGEIGGNAEEEAAAYIKEHVTKPVVGYIAGVTAP
KGKRMGHAGAIIAGGKGTADDKFAALEAAGVKTVRSLAEIGNAVKAILPQ
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattttaattaataaaaataccaaagttatttgccagggttttaccggtagccaa
gggactttccactctgaacaagctatcgcctacggcacaaaaatggttggcggtgtcaca
ccaggcaaaggcggtactcaacatctgggcctgccggtcttcaatactgtgcgtgaagct
gtagagacgaccggtgcgactgcatctgttatctatgtgccagcaccgttttgcaaagac
tcgattctggaagccatcgacgccggtatcaaactgattatctgtattactgaaggcatc
ccaacgctggatatgctggtggtaaaagtcagattagaacagtctgatgcgcgcatgatc
ggcccgaactgcccaggtgttatcacccctggcgaatgtaagattggtatcatgccgggt
catattcacttgccaggtaaagtcggtatcgtctctcggtcaggtacgttgacttatgaa
gcggtaaaacagacaactgacattggttttggtcaatcgacctgtgtcggtattggtggc
gacccaatcccaggttccaactttattgatattctgaagttgttccaggaagacccacag
actgaagttatcgtgatgatcggtgaaatcggcggtaacgcagaagaagaagcggcagct
tatatcaaagagcacgtgactaaacctgttgtcggttacattgctggcgtcactgcgcca
aaaggcaaacgtatgggccacgcaggtgccatcattgctggcggtaagggtacggcagat
gataaattcgcggctctggaagcagctggcgtgaaaacagtacgtagcttggctgaaatt
ggtaatgcggttaaagcgatattgccgcagtaa

DBGET integrated database retrieval system