KEGG   Yersinia aldovae: AT01_1005Help
Entry
AT01_1005         CDS       T03605                                 

Gene name
ltaE
Definition
(GenBank) low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
yal  Yersinia aldovae
Pathway
yal00260  Glycine, serine and threonine metabolism
yal01100  Metabolic pathways
yal01110  Biosynthesis of secondary metabolites
yal01120  Microbial metabolism in diverse environments
yal01130  Biosynthesis of antibiotics
yal01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:yal00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AT01_1005 (ltaE)
Enzymes [BR:yal01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     AT01_1005 (ltaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AJJ62038
Position
1069270..1070289
Genome map
AA seq 339 aa AA seqDB search
MLIDLRSDTVTQPCAAMRNAMANADVGDDVYGDDPTVNQLEAEAARLSGKAAALFLPSGT
QANLVALLTHCQRGEEYIVGQKAHNYLYEAGGAAVLGSIQPQPIDANDDGTLPLDKVLAA
IKPDDIHFAQTRLLSLENTHSGKVLPLSYLQQAWALTREKKLALHIDGARIFNAAVALNV
PLSEISQYCDTLTICLSKGLGAPVGSLLCGSAEYIQRARRWRKMTGGGMRQAGILAAAGL
YALQNNVTRLKDDHDNALWLEAQLRALDIEIVAPGAQTNVLYIKQSAENAAKLGPWMQQH
GILISAGPITRILTHMNISRQSLEKVVALWREFLIEQRS
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgctgattgacttacgcagtgacacagtaacccaaccctgcgctgcaatgcgcaacgct
atggccaatgccgatgtcggcgacgatgtgtacggtgatgatcctacggttaaccaactg
gaagctgaagctgcaaggctatcagggaaagcggcggcattgttcctgccaagcggtacc
caggccaatctggtggcactgttgacccactgccaacgtggtgaagaatatattgtcggc
cagaaagcgcataattatctgtatgaagccggcggtgccgctgtacttggtagcatccaa
ccacaacctattgatgccaatgatgatggcaccctgccactggataaagtgctggccgcc
atcaaacccgatgatattcatttcgcacaaacacgcttgttaagcctggaaaatacccac
agtggcaaagtgttaccactgagttatttacagcaggcgtgggcattgacccgcgagaag
aaactggcgctacatattgatggcgcacgtattttcaatgcggcggtagcgctgaatgtc
ccgttgagcgagataagccaatattgcgacaccctgacaatttgcctctctaaggggtta
ggcgcgccggtaggctccctgttgtgtggcagcgctgaatacatccaacgcgcccgtcgc
tggcgcaaaatgaccggtggcggtatgcgtcaggccggtattctggcggcagccgggcta
tatgcgttgcaaaacaatgtcacgcggctgaaagacgatcacgacaacgccttatggctg
gaggcgcaattacgcgcactggatatcgagatagtggctccgggggcgcaaactaacgtg
ttgtatattaagcaatcggctgaaaatgcagccaaacttggcccgtggatgcaacaacac
gggatacttatcagcgccggcccgatcacccgcatattgactcacatgaatatcagccgc
cagagcctggaaaaagtggtggcgctatggcgtgagtttttgatagagcaacgctcatga

DBGET integrated database retrieval system