KEGG   Yersinia aldovae: AT01_1607Help
Entry
AT01_1607         CDS       T03605                                 

Definition
(GenBank) RNA pseudouridylate synthase family protein
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
yal  Yersinia aldovae
Brite
KEGG Orthology (KO) [BR:yal00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:yal03016]
    AT01_1607
Enzymes [BR:yal01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     AT01_1607
Transfer RNA biogenesis [BR:yal03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    AT01_1607
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AJJ62013
Position
complement(1712537..1713310)
Genome map
AA seq 257 aa AA seqDB search
MLEILYQDEHIVAVNKPAGWLVHRSWLDSNETVFVMQTVRDQIGQHVYTVHRLDRPTSGV
LLMALSSEVARTLSLQFEQHQIQKTYHAVVRGYVLESGTVDYAMAEELDKIADKRARQDK
APQPSVTHYQPVAQVEVPLAIGRYETARYSLMALKPETGRKHQLRRHMAHIRHPIIGDTA
HGDLRQNRGVAEHFACPRLMLHASHLQLNHPVTGEALLLTARWDASWQGLMSHFGWSGIA
PDVERVEFSATAGQDSE
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgctggaaatactctatcaagatgaacatattgtcgcggtaaataaacctgccggatgg
ttagtacaccgcagttggctggacagtaatgaaacggtatttgtgatgcagacggtgcgc
gaccagattggtcagcatgtgtataccgtccatcggttagaccggccaacctctggcgta
ctgctaatggcgctatctagtgaggtagcccgtacactttccttgcaatttgaacaacat
caaatccagaaaacatatcatgcggtggttcgtggttatgtgctggaaagcggcaccgtt
gattatgcgatggctgaagagctggataaaattgccgataaacgggccagacaagacaaa
gcgccgcagccatccgtgacccattatcagccggtggctcaagtggaagtaccattagct
attgggcgctatgaaaccgcccgctacagtctgatggcactcaagccagaaacagggcgt
aagcatcaattaaggcgtcatatggcgcatattcgccaccctatcatcggtgacaccgcg
cacggtgatttgcgccagaatcggggagtggcggagcattttgcttgtccgcggctgatg
ctccatgccagtcatttacaactaaaccatccggtaaccggtgaagcacttttgctcacc
gctcgctgggatgcgtcgtggcaaggattgatgtcacactttggttggtctggtattgct
cctgatgttgaaagggttgagttttctgctactgcgggtcaggatagtgagtaa

DBGET integrated database retrieval system