KEGG   Yersinia aldovae: AT01_2450Help
Entry
AT01_2450         CDS       T03605                                 

Gene name
yihX
Definition
(GenBank) phosphatase yihX
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
yal  Yersinia aldovae
Pathway
yal00010  Glycolysis / Gluconeogenesis
yal01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:yal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT01_2450 (yihX)
Enzymes [BR:yal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     AT01_2450 (yihX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD SHOCT Acid_PPase Hydrolase_like PNK3P
Motif
Other DBs
NCBI-ProteinID: AJJ63509
Position
complement(2644893..2645480)
Genome map
AA seq 195 aa AA seqDB search
MLYIFDLGNVIVDIDFKRVLGVWSKLSSVPLATLSERFTMGEVFQQHERGEISDEDFARQ
LSDEMGLSLSFEQFAEGWQAVFVALRPEVVAIMHKLREEGHRVVVLSNTNRLHCNYWPQH
FPEVAAAADHMYLSQDLGMRKPEARIYQHVLHAENVPPEQAVFFDDIEANIVAARIEGMT
AIHVTDRKVIPAYFS
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgctgtatatctttgatctagggaatgtgattgttgatatcgactttaaacgcgttttg
ggtgtctggagtaagttaagcagtgttccgctggcgacattgagcgaacgttttactatg
ggcgaagtattccagcagcatgaacgaggggaaatcagtgatgaggactttgcgcgtcag
ctcagtgatgagatggggctatccctaagctttgaacagtttgctgaaggctggcaggcg
gtatttgtcgcgttgcgaccggaagtcgtcgcgattatgcataaactgcgtgaggaaggg
catcgcgttgtggtgttatctaataccaatcgtctgcattgcaattactggccacagcac
ttccctgaagttgctgccgccgctgaccacatgtatttgtcgcaggatttggggatgcgt
aaaccggaagccagaatctatcaacatgtactccatgctgaaaatgttccgccagagcag
gcggtgttctttgatgatattgaagcaaatattgttgccgccagaattgaaggtatgacc
gctattcatgtcactgaccgaaaggttattcctgcttatttttcctga

DBGET integrated database retrieval system