KEGG   Yersinia aldovae: AT01_258Help
Entry
AT01_258          CDS       T03605                                 

Definition
(GenBank) glutathione peroxidase family protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
yal  Yersinia aldovae
Pathway
yal00480  Glutathione metabolism
yal00590  Arachidonic acid metabolism
yal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    AT01_258
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AT01_258
Enzymes [BR:yal01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AT01_258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA AHJR-like
Motif
Other DBs
NCBI-ProteinID: AJJ63671
Position
256178..256732
Genome map
AA seq 184 aa AA seqDB search
MSNPIYAIPLQSIDHQSVLLDKYKGSVLLVVNVASQCGLTKQYEGLEKLYKTYQQQGFEV
LGFPSNEFAGQEPGSDEEIHAFCRGTFGVEFPMFSKIEVNGSQRHPLYKHLIAAKSVAVK
PEGSEFYQRLASKGREPKQQGDILWNFEKFLISRDGVVLDRFAPDMTPEDPILIKAINQA
VARH
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatccaatttatgctatcccgctgcaatccattgatcatcaatctgttctactg
gataagtataaaggctcggtattgctggtggtgaatgtggcttctcaatgtggcctgacc
aagcagtatgaagggctggaaaaactgtataaaacctatcagcagcagggttttgaagta
ttaggcttcccaagcaatgaatttgctggccaagagccgggcagtgatgaggaaattcac
gcattctgccgtggaacgtttggggtggaattccctatgtttagcaaaatcgaggtcaat
ggttcccagcgtcatcctttatataagcacttgattgcggctaaatctgttgcagtaaaa
ccggaaggaagtgagttttaccaacgcttggcgagtaaaggccgtgaaccaaaacagcag
ggtgatattctgtggaattttgaaaagttcttaattagccgtgatggcgtggtgctcgac
cgtttcgctccagacatgacgccagaagatcctattttaattaaggcaattaatcaggct
gtggctcgccattag

DBGET integrated database retrieval system