KEGG   Yersinia aldovae: AT01_262Help
Entry
AT01_262          CDS       T03605                                 

Definition
(GenBank) 3-beta hydroxysteroid dehydrogenase/isomerase family protein
  KO
K10011  UDP-4-amino-4-deoxy-L-arabinose formyltransferase / UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating) [EC:2.1.2.13 1.1.1.305]
Organism
yal  Yersinia aldovae
Pathway
yal00520  Amino sugar and nucleotide sugar metabolism
yal01100  Metabolic pathways
yal01503  Cationic antimicrobial peptide (CAMP) resistance
Module
yal_M00761  Undecaprenylphosphate alpha-L-Ara4N biosynthesis, UDP-GlcA => undecaprenyl phosphate alpha-L-Ara4N
Brite
KEGG Orthology (KO) [BR:yal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AT01_262
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    AT01_262
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:yal01005]
    AT01_262
Enzymes [BR:yal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.305  UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating)
     AT01_262
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.13  UDP-4-amino-4-deoxy-L-arabinose formyltransferase
     AT01_262
Lipopolysaccharide biosynthesis proteins [BR:yal01005]
 Unusual sugar
  AT01_262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase Formyl_trans_N GDP_Man_Dehyd Formyl_trans_C 3Beta_HSD NAD_binding_10 NAD_binding_4 TrkA_N
Motif
Other DBs
NCBI-ProteinID: AJJ63102
Position
259980..261983
Genome map
AA seq 667 aa AA seqDB search
MKAIVFAYHDIGCVGLKALVEAGYDIQAVFTHTDAPGENRFFSSVARVAADLELPVHAPE
DVNHPLWVERIRQLQPDIIFSFYYRNMLSDEILSLVPQGGFNLHGSLLPKYRGRAPINWA
LVNGETETGVTLHQMVRKADAGSIVGQHKVAISPTDTALTLHAKVRDAAKELLVDLLPEM
KGKSLSLTPQKEADASYFGRRTAADGEIHWHKSASAINNLVRAVTEPYPGAFSYLGQRKL
TIWRSRPLNMEHGKLPGTVLSILPLTVACGEGALEIIAGQGDADLYVQGNRLAQEMGIVT
DVRLGNKPSKILKRRTRVLILGVNGFIGNHLTERLLRDDRYEVYGLDIGSDAISRFLDNP
YFHFVEGDISIHSEWIEYHIKKCDVILPLVAIATPIEYTRNPLRVFELDFEENLKIVRDC
VKYNKRIVFPSTSEVYGMCDDKEFDEDTSRLIVGPINKQRWIYSVSKQLLDRVIWAYGAK
EGLKFTLFRPFNWMGPRLDNLDAARIGSSRAITQLILNLVEGSPIKLVDGGAQKRCFTDI
HDGIEALFRIIENRDGCCDGEIINIGNPTNEASIRELAEMLLSSFEKHELRDHFPPFAGF
KDIESSAYYGKGYQDVEYRTPSISNARRILHWQPEIAMQQTVTETLDFFLRGAVLEQNET
MKDESRV
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgattgtatttgcctatcacgatattggctgcgtaggtttgaaagcattagtt
gaagcaggttacgatattcaggccgtatttactcatactgacgctcccggtgagaatcgt
tttttctcttctgttgcccgagttgccgctgatcttgaactgcctgtccatgcaccggag
gatgtgaatcatcctttatgggttgagcgtattcgccaattacagccggatattattttt
tctttctattaccgcaatatgctgagtgacgagatattatcactcgtaccacaaggcggg
tttaatttacatggctctttattgccaaagtatcgtgggcgtgcgcccattaactgggct
ttggttaatggcgagactgaaaccggtgttacgttgcaccaaatggtacgcaaagctgat
gccgggtcgatcgtagggcaacataaagtggctatcagtcctactgatactgcattgact
ttacatgcaaaagtgcgagacgcagctaaagagttattagttgatttactgcctgaaatg
aaaggtaagtcactgagtttaacgccacaaaaagaagccgatgccagttattttggccgt
cgtactgcggcggatggcgaaattcattggcataagtctgcatccgcaattaacaatctg
gtacgcgcagtaacagagccttatcctggtgctttcagttacttagggcagcgtaaactg
accatctggcgttcacgaccgctgaatatggaacacggtaaattgcctggtacggtgctc
tctatcttgccattaaccgtggcatgtggtgaaggtgcattggagattattgcggggcaa
ggtgatgctgacttatatgttcagggtaaccgactggcgcaagagatgggtatcgttacc
gatgtgcgtttgggtaataagccgagcaaaatactcaagaggcgtacacgagtactgatt
cttggtgttaatggctttatcggcaatcacttaactgagcgtctgttacgcgatgaccgc
tatgaagtttatggcctggatattggttctgatgcgattagccgcttcctcgataaccct
tatttccattttgtggagggggatatcagcatccattcggaatggattgagtaccacatt
aaaaagtgtgacgtaatcttaccattggtagcgattgctactccaattgaatatacccgt
aacccactacgcgtttttgaattggatttcgaagagaatctgaagattgtgcgtgattgc
gttaaatacaataaacgtattgttttcccgtcaacatctgaagtctacggcatgtgtgat
gacaaagagtttgatgaagacacatcacgcttgattgttggcccgatcaataaacagcgc
tggatttattcagtatcaaaacaattgctggaccgtgttatctgggcttacggtgctaaa
gaggggctgaagttcacgttgttccgtccatttaactggatggggccacgtttggataac
cttgatgctgcgcgcattggtagttctcgcgccatcacacaacttattctcaatctggtt
gaaggctcaccaataaaattagtggacggcggcgcacaaaaacgttgctttaccgatatt
cacgatggcattgaggcattattccgcattattgagaatcgtgatggctgctgtgatggg
gagatcattaatattggtaacccaactaatgaagccagtattcgtgaattggccgaaatg
ttactgagcagctttgagaaacacgaattacgcgatcatttcccgccattcgctggcttt
aaagatattgaaagtagtgcatattacggtaaaggctatcaggatgttgagtatcgcacg
ccaagtattagcaatgcgcgccgtattctgcattggcaacccgaaattgccatgcagcaa
actgtcactgaaacattggactttttcctgcgtggtgccgtgcttgaacaaaacgaaact
atgaaggatgagtctcgcgtatga

DBGET integrated database retrieval system