KEGG   Yersinia aldovae: AT01_3143Help
Entry
AT01_3143         CDS       T03605                                 

Definition
(GenBank) hypothetical protein
  KO
K06195  ApaG protein
Organism
yal  Yersinia aldovae
Brite
KEGG Orthology (KO) [BR:yal00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    AT01_3143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AJJ62183
Position
complement(3430863..3431240)
Genome map
AA seq 125 aa AA seqDB search
MIEQPRVCVQVQSIYVETQSIPEEERFVFAYTVTIRNLGRSNVQLIGRYWLITNSNGRQT
EVQGEGVIGEQPLILPGNEFQYTSGAVLETPLGTMEGHYEMVDHLGQAFRTAIPVFRLAI
PALIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgattgaacagccccgcgtttgtgtacaggtgcaaagtatctatgtggaaacccaatcg
atacctgaagaggagcgtttcgtcttcgcctatactgtgacgattcgtaatctgggccgt
tcaaatgtgcaactgattggccgctattggttaattaccaatagcaatggtcgccaaact
gaagttcagggtgaaggggtcatcggcgagcagccgttgatcctgccaggtaatgagttc
caatacaccagcggcgcggttctggaaacgcctctgggtaccatggaagggcattatgag
atggttgaccacctcggtcaggctttccgtactgcgattccggtgttccgtttagcgatc
ccagcactgatccattaa

DBGET integrated database retrieval system