KEGG   Yersinia aldovae: AT01_3375Help
Entry
AT01_3375         CDS       T03605                                 

Gene name
rluD
Definition
(GenBank) ribosomal large subunit pseudouridine synthase D
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
yal  Yersinia aldovae
Brite
KEGG Orthology (KO) [BR:yal00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:yal03009]
    AT01_3375 (rluD)
Enzymes [BR:yal01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     AT01_3375 (rluD)
Ribosome biogenesis [BR:yal03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    AT01_3375 (rluD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 S4_2 TruB_N
Motif
Other DBs
NCBI-ProteinID: AJJ62394
Position
3707630..3708607
Genome map
AA seq 325 aa AA seqDB search
MAQQVQLSATVAESQLGQRLDQALAELFPDYSRSRIKEWILEDKVTVNGKTINKPKEKVL
GGELVAIDAQIEEDARWAPQEIPLDIVYEDSDILVINKPRGLVVHPGAGNPDGTVLNALL
YYYPEIMDVPRAGIVHRLDKDTTGLMVVAKTVPAQTRLVEALQAREITREYEAVAIGNMT
AGGRVDEPISRHSTKRTHMAVHPMGKPATTHYRIMEHFRAHTRLRLRLETGRTHQIRVHI
SHINHPLVGDQLYGGRPRPPKGASDSFISILRGFDRQALHATMLRLYHPISGIQMEWHAA
LPEDMVELINALKADTEEFKDQMDW
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggcacaacaagtacaactcagcgcaacggtggccgaatcacaactcggtcaacggtta
gatcaggctttggccgaattgttccctgattattcaagatctcgcataaaagagtggatc
ttggaagacaaagtcacggtaaacggcaaaacaattaacaagcctaaagaaaaagtgttg
ggtggtgagctcgtcgcaattgacgcgcaaattgaggaagatgcccgttgggcgcctcaa
gaaatcccactggatatcgtctatgaagatagcgatattctggttattaataaaccccgc
ggtttagttgttcatccgggggcgggtaatccagatggcaccgttctgaatgcgctgctc
tattattatccggaaatcatggatgtcccacgcgcgggtatcgtgcatcgcctggataaa
gacaccacaggcttgatggtggtggcgaaaaccgttccggcacagactcgtttggtggaa
gcgctgcaagcgcgcgaaattacccgtgaatacgaagcggtggcaatcggcaatatgacc
gccggtggcagagttgacgagccaatttctcgccactctaccaagcgcacgcatatggcg
gtgcatccaatgggcaaaccggcaacaacccattaccgtattatggagcatttccgtgct
cacacccgcctgcgcctgcgtctggagacgggccgtacgcaccagatccgtgtgcatata
tcgcatatcaaccatccgctggtaggggatcaactctacggtggtcgcccgcgcccgcca
aaaggggcttctgattcctttatctcaattctgcgcggttttgaccgtcaggcgctgcat
gcaactatgttgcgtttgtatcacccaatcagtggcattcaaatggaatggcacgcagca
ttaccagaagatatggttgagctgattaatgcgctgaaagccgatactgaagaattcaaa
gatcagatggattggtaa

DBGET integrated database retrieval system