KEGG   Yersinia aldovae: AT01_693Help
Entry
AT01_693          CDS       T03605                                 

Definition
(GenBank) nucleotidyl transferase family protein
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
yal  Yersinia aldovae
Pathway
yal00051  Fructose and mannose metabolism
yal00520  Amino sugar and nucleotide sugar metabolism
yal01100  Metabolic pathways
yal01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:yal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    AT01_693
   00520 Amino sugar and nucleotide sugar metabolism
    AT01_693
Enzymes [BR:yal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     AT01_693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 Beta_helix
Motif
Other DBs
NCBI-ProteinID: AJJ62600
Position
complement(753892..755055)
Genome map
AA seq 387 aa AA seqDB search
MKAMILAAGKGTRARPLTTILPKPMIPLIRKPIMESIVEHLRQYGFNQLMVNTSYLSMDI
ENYFRDGHAWGVEMGYSYEGIMEGNTFVDNVLGSAGGMKHIQNFSGFFDETFVVVCGDAL
IDVDFDQVLAFHRARKSVATLVMRPVSADQVNKYGIVVTDDQGRVSKFQEKPKIEEALSN
NANTGIYVFEPEIFDYIPDGIEYDIGSQLFPQLAELGIPFYGIALPFQWVDIGSLQDFWH
VNRMILNQELPHYPMPGIKVAPQVWCGLNVKADFSTLDIEGPVYIGSSTEIQPGVTIKGP
AIIGAGCLLEQGAVIDQSFIADYTRVGGIAHLHQQIIFAGKVISPEGIAIDLSEAGLNWL
IDDKRRKDIITAEKSLFNEFLHKDMLL
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccatgatccttgctgccgggaaaggaaccagagccagaccactgaccaccata
ttgccgaaaccgatgatcccattgattcgcaaacctattatggaatcaattgttgagcat
ttaagacagtatggttttaatcagttaatggtgaataccagttatttgtctatggatata
gagaattattttcgtgatggtcatgcctggggcgtcgaaatgggttactcctatgaaggc
attatggaggggaatacctttgtcgataatgtattaggttccgccggtggcatgaaacat
attcagaacttctcgggtttttttgatgagacttttgtggtggtgtgtggtgacgcatta
attgatgtagactttgaccaggtattggctttccaccgggccagaaaaagtgtggcgact
ttggtgatgcgccctgtctcagcggatcaggtgaataaatacggtattgttgtcactgat
gatcaaggtagagtcagtaagtttcaggaaaaacctaaaatagaagaggcattatcaaac
aatgccaatactggcatttatgtttttgaacccgaaatattcgattatattcctgatggt
attgagtatgatattggtagtcagttatttcctcagcttgctgaattaggcattcctttc
tatggtattgccttaccattccaatgggttgatattgggtcattacaggatttttggcat
gtgaaccggatgatcctcaatcaagagttaccacattatcccatgccaggcattaaagtt
gccccccaagtctggtgtgggcttaacgttaaagctgatttttcgaccttagatattgaa
gggcctgtttatattggcagtagtacagaaatacaacccggagtgacgattaaagggcca
gcaattattggtgctgggtgtttattagagcagggggctgtcattgatcaaagttttatt
gctgattacacccgcgttgggggtatcgcgcatttacatcaacagataatttttgctggg
aaggttatttcgcctgagggaatcgcaattgatttatctgaggccggtctaaattggctt
attgatgataaacgacgtaaggatattattacggcggagaagtctttattcaatgagttt
cttcataaagatatgttgctatga

DBGET integrated database retrieval system