KEGG   Yersinia aldovae: AT01_848Help
Entry
AT01_848          CDS       T03605                                 

Definition
(GenBank) sucrose-6-phosphate hydrolase family protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
yal  Yersinia aldovae
Pathway
yal00052  Galactose metabolism
yal00500  Starch and sucrose metabolism
yal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AT01_848
   00500 Starch and sucrose metabolism
    AT01_848
Enzymes [BR:yal01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     AT01_848
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-ProteinID: AJJ64231
Position
complement(879701..881065)
Genome map
AA seq 454 aa AA seqDB search
MNDPNGLIFFNGQYHAFYQHHPYDENWGPMHWGHATSLDMLSWQHQPIALAPGDLWDKDG
CFSGCAVDDNGVLSLIYTGHVWLNGEGDDNAIREVQCLATSQDGIHFDKQGVVLNPPEGI
MHFRDPKVWFEDDCWWMVVGARDARDHGQVLLYRGSSLQQWQFMQVLARADDSMGYMWEC
PDFFPLGNERILMFSPQGLVAKGYHNRNLFQSGVLRGKWQPGGGFKPSQLFTELDLGHDF
YAPQSLLTADGRRVIIGWMDMWQSPMPTKTDNWSGCLTLPRELLIDSKGKLLIQPVREVE
ALRQTGQFITSMTLAQEKQLLHENCQSLELQLTWDTTASHAERYGVQLADVQGTGGKVSV
YVDNQASRLILDRYYPQYGLTGCRSVALPEQGLLSLRIFIDSSSVEVFINGGQACMSSRI
YPTEHERCLSLYAENGQAQLLHGEYWQLVAKSSR
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaccccaacgggctaattttttttaacggacagtatcacgcgttttatcagcac
cacccttatgatgaaaattgggggccgatgcattggggccatgcaaccagcctcgatatg
ttgagttggcagcatcaacccattgccttagctccgggtgatttatgggataaagacggc
tgtttttctggttgcgcggtagacgataacggtgtgttaagtctgatttataccggacat
gtttggcttaacggtgagggtgatgacaacgctattcgcgaggtacagtgcctggcgacc
agtcaggacgggatacattttgacaaacaaggtgtggtactgaatccacccgagggaatc
atgcattttcgcgatcccaaagtgtggtttgaagatgattgttggtggatggtggtcggt
gctcgagatgcgcgagatcatgggcaagtcttgttatatcgcggcagttcattgcagcaa
tggcaatttatgcaagttttagcgcgcgcagacgacagcatgggatatatgtgggaatgt
ccagatttcttcccgttagggaatgaacgcattctgatgttttcaccgcaggggctggta
gcaaaaggctaccacaatcgcaatttgttccaaagcggggttttgcgtggtaaatggcaa
ccagggggcggttttaagccatctcaactttttaccgaactggatctgggtcatgatttc
tatgcaccacaatctctgcttacagccgatgggcggcgagtcattattggttggatggat
atgtggcaatcgccgatgccgaccaaaaccgataattggagtggctgcttaaccttacca
cgagagctactgattgattctaaaggtaaattactaatacaaccggtgcgagaggtagaa
gcactaaggcaaaccggtcaattcatcacatcaatgacactggcccaagagaaacaactt
ttacatgaaaattgccagagtctggagctgcaactgacatgggataccacagccagtcat
gcagaaagatatggtgtgcagttagccgatgtccaaggaacggggggtaaagtttcagtt
tatgtcgataatcaggctagtcgactgattttggatagatattacccacaatatggactg
acggggtgtcgcagtgtggcattaccagaacaggggttattatcattacgtatatttatt
gatagttcgtctgtggaggtatttatcaatggcgggcaagcttgtatgagcagtcgtatt
tatccaaccgagcatgaacgctgtttatccctgtatgcggagaatggtcaggcccagcta
ctacacggcgaatactggcagttagtggctaaatcatcacgttga

DBGET integrated database retrieval system