KEGG   Yangia sp. CCB-MM3: AYJ57_05440Help
Entry
AYJ57_05440       CDS       T04443                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
yan  Yangia sp. CCB-MM3
Pathway
yan00010  Glycolysis / Gluconeogenesis
yan00053  Ascorbate and aldarate metabolism
yan00071  Fatty acid degradation
yan00280  Valine, leucine and isoleucine degradation
yan00310  Lysine degradation
yan00330  Arginine and proline metabolism
yan00340  Histidine metabolism
yan00380  Tryptophan metabolism
yan00410  beta-Alanine metabolism
yan00561  Glycerolipid metabolism
yan00620  Pyruvate metabolism
yan00625  Chloroalkane and chloroalkene degradation
yan00903  Limonene and pinene degradation
yan01100  Metabolic pathways
yan01110  Biosynthesis of secondary metabolites
yan01120  Microbial metabolism in diverse environments
yan01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:yan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AYJ57_05440
   00053 Ascorbate and aldarate metabolism
    AYJ57_05440
   00620 Pyruvate metabolism
    AYJ57_05440
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AYJ57_05440
   00561 Glycerolipid metabolism
    AYJ57_05440
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AYJ57_05440
   00310 Lysine degradation
    AYJ57_05440
   00330 Arginine and proline metabolism
    AYJ57_05440
   00340 Histidine metabolism
    AYJ57_05440
   00380 Tryptophan metabolism
    AYJ57_05440
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AYJ57_05440
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AYJ57_05440
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AYJ57_05440
Enzymes [BR:yan01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     AYJ57_05440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: ANT59862
UniProt: A0A1B1PMW1
Position
1:complement(1117498..1119837)
Genome map
AA seq 779 aa AA seqDB search
MGVKEIFESMDYGPAPESAADALTWIVDQGSRFGCYIDGGFTKPGATFESRNPATGEVLA
EVTQATQGDVDAAVKAARAAQPGWAKLGGKGRARFLYALARLLQKHARLMAVLETLDNGK
PIRESRDIDVPLVARHFYYHAGCAQLMDAELPGREALGVCGQIVPWNFPLLMLAWKIAPA
LAMGNTVVLKPAEWTSLTALCFADLCQQAGLPKGVVNIVTGDGAVGEMITGAEVDKIAFT
GSTEVGRKIRAATAGSGKSLTLELGGKSAYVVFEDADLDSAVEGLVDAIWFNQGQVCCAG
SRLLVQEGIAERFHDKLKARMDKLRLGDPLDKCIDIGAIVDPEQKGRIEALMQKAAGEGE
VYTGCAAPEGCFIAPTLVTGLSPASLLMQEEIFGPVLVSTTFRTPSEAVQIANNTRYGLA
ASVWSENINTALDVAPKLEAGVVWINGSNMFDAAAPFGGLRESGFGREGGWEGLGAYTRP
AGKAKALKKVEPFAGESAEPQDVDRTAKLYIGGKQARPDGGYAQNIYDKKGRLLGQAPIS
SRKDIRNAVEAARGAAGWSSATAHNRAQVIYFIAENLQARAGEFAARIDAMTGGKGGAAE
VEASVDRLFTYAAWADKYEGAVKPVPLRGTALALRKPTGVIGAFCPDEAPLLGLVSVMAP
AIAMGNRVVLVASEPFPLAATDFYQVLDTSDLPGGVVNILTGPHEELASTLASHMDVEAV
WSFSSSDLSKAIEAGAAGNLKRTWVNDGKARDWSAAAGEGEPFLEAATEVQTVWIPWGA
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtgaaagagattttcgagagcatggactacggaccggcccccgagagcgccgcg
gatgcgctgacttggattgtcgatcagggctcgcgttttggctgctatatcgacggcggc
ttcaccaagccgggcgcgaccttcgagagccgcaaccccgccaccggcgaggtgctggcc
gaggtcacgcaggccacgcagggcgacgtcgacgcagcggtgaaagccgcgcgcgcggcg
cagccgggctgggcgaagctgggcggcaagggccgggcgcgcttcctctatgcgctggcg
cggctgctgcagaaacatgcgcggctgatggcggtgctggagacgctggacaacggcaag
ccgatccgcgagagccgcgacatcgacgtgccgctcgtggcgcggcatttctactaccac
gcgggctgtgcgcagctgatggacgcggagcttccggggcgggaggcgctgggcgtctgc
ggccagatcgtgccgtggaacttcccgctgctgatgctggcctggaaaatcgctccggcg
ctggcgatgggcaatacggtggtgctgaaacccgccgagtggacctcgctcaccgcgctc
tgctttgccgatctctgccagcaggccgggctgccgaagggcgtcgtgaacatcgtcacc
ggcgacggtgccgtgggcgagatgatcaccggcgccgaggtcgacaagatcgccttcacc
ggctcgaccgaggtggggcgcaagatccgcgccgccaccgcgggcagcggcaagtcgctg
acgctcgagctgggcggcaaatcggcctatgtggtctttgaagacgcagacctcgacagc
gcggtcgaagggctggtggacgccatctggttcaaccaggggcaggtctgctgcgcgggc
tcgcgcctgctggtacaggagggcatcgccgagcgcttccacgacaagctcaaggcacgg
atggacaagctgcgccttggcgatccgctcgacaagtgcatcgacatcggcgccatcgtc
gatcccgagcagaagggccggattgaggcgctgatgcagaaggccgcgggtgagggcgag
gtctacaccggttgcgccgcgcccgagggctgtttcatcgcgccgacgctggtgacgggt
ctctcgcccgcatcgctgctgatgcaggaagagatcttcggcccggtgctggtctcgacc
accttccgcaccccgtccgaggcggtgcagatcgccaacaacacgcgctatggcctcgcg
gcctcggtctggtcggaaaacatcaacaccgccctcgacgtggcgccgaagctcgaggcc
ggggtggtctggatcaacggcagcaatatgttcgatgcggcggcgccctttggcgggttg
cgcgagagcggctttggccgcgagggcggctgggaagggcttggcgcctacacgcggccg
gcgggcaaggcgaaggcgctgaagaaggttgagcccttcgccggtgagagcgccgagccg
caggatgtggaccgcacagccaagctctacatcggcggcaagcaggcgcggcccgatggg
ggctacgcgcagaacatctacgacaagaagggccgtctgctggggcaggcgccgatctcg
tcgcgcaaggacatccgcaacgccgtcgaggcggcgcggggggcggcgggctggtcgtcg
gccacggcacacaaccgcgcgcaggtgatctatttcatcgccgagaacctgcaggcgcgg
gcgggcgagttcgcggcgcggatcgacgcgatgaccggcggcaagggaggcgcggcagag
gtcgaggcctcggtcgaccggctgttcacctatgccgcttgggccgacaaatacgagggt
gcggtgaagcccgtcccgctgcgcggcaccgcgctggctctgcgcaagcccaccggtgtg
atcggtgccttctgcccggacgaggcgccgctgctggggctggtgtcggtgatggcgccc
gctatcgctatgggtaaccgcgtggtgctggtcgcctccgagcccttcccgttggcggcg
acggatttctatcaggtgctcgacacgtcggacctgccgggcggggtggtcaacatcctg
accggtccgcatgaagagcttgcctcgacccttgccagccacatggatgtggaggcggtg
tggagcttttcctcgtcggacctgtcgaaagccatcgaggcgggcgctgcgggcaacctc
aagcgcacatgggtcaacgacggcaaggcgcgcgactggtccgcggcggcgggggagggc
gagcccttcctcgaggcggcgaccgaggtgcagaccgtctggatcccctggggcgcgtga

DBGET integrated database retrieval system