KEGG   Yangia sp. CCB-MM3: AYJ57_09725Help
Entry
AYJ57_09725       CDS       T04443                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
yan  Yangia sp. CCB-MM3
Pathway
yan00071  Fatty acid degradation
yan00072  Synthesis and degradation of ketone bodies
yan00280  Valine, leucine and isoleucine degradation
yan00310  Lysine degradation
yan00362  Benzoate degradation
yan00380  Tryptophan metabolism
yan00620  Pyruvate metabolism
yan00630  Glyoxylate and dicarboxylate metabolism
yan00640  Propanoate metabolism
yan00650  Butanoate metabolism
yan00900  Terpenoid backbone biosynthesis
yan01100  Metabolic pathways
yan01110  Biosynthesis of secondary metabolites
yan01120  Microbial metabolism in diverse environments
yan01130  Biosynthesis of antibiotics
yan01200  Carbon metabolism
yan01212  Fatty acid metabolism
yan02020  Two-component system
Brite
KEGG Orthology (KO) [BR:yan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AYJ57_09725
   00630 Glyoxylate and dicarboxylate metabolism
    AYJ57_09725
   00640 Propanoate metabolism
    AYJ57_09725
   00650 Butanoate metabolism
    AYJ57_09725
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AYJ57_09725
   00072 Synthesis and degradation of ketone bodies
    AYJ57_09725
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AYJ57_09725
   00310 Lysine degradation
    AYJ57_09725
   00380 Tryptophan metabolism
    AYJ57_09725
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AYJ57_09725
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AYJ57_09725
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AYJ57_09725
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:yan04147]
    AYJ57_09725
Enzymes [BR:yan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AYJ57_09725
Exosome [BR:yan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AYJ57_09725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ANT60620
UniProt: A0A1B1PQ03
Position
1:complement(2001316..2002491)
Genome map
AA seq 391 aa AA seqDB search
MTNVVIASAARTAVGSFSGAFANTPAHDLGAAVLEALVARAGIEKGEVSETILGQVLTAA
QGQNPARQAHINAGLPKESAAWSINQVCGSGLRTVMLGAQHILLGDADIVAAGGQENMTL
SPHAAHLRAGHKMGDVKYIDTMIRDGLWDAFNGYHMGQTAENVAEQWQISREQQDEFAVA
SQNKAEAAQNAGKFDDEVIPFVVKHRKGDITVDKDEYIRHGATIEAMQKLRPAFTKDGSV
TAANASGINDGAAGVLLMSAENAEKRGIQPLARIASYATAGLDPSIMGVGPIHASRKALE
KAGWKPEDLDLVEANEAFAAQACAVNKDMGWDPAIVNVNGGAIAIGHPIGASGARILNTL
LFEMQRRDAKKGLATLCIGGGMGVALCVERD
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaccaatgtcgtaatcgcgtctgccgcacgtaccgccgtcggcagctttagcggcgct
tttgccaatacacctgcgcatgatctgggggccgccgtgctcgaagcgctggtggcacgc
gctggaatcgagaagggagaggtctcggagaccattctcggtcaggtgctgaccgccgcg
cagggccagaacccggcgcgtcaggcgcatatcaatgccggtcttcccaaggaaagcgcc
gcatggtcgatcaatcaggtctgcggctcgggcctgcgcaccgtcatgctgggcgcccag
cacatcctgctgggggacgccgatatcgtcgccgcgggcggtcaggagaacatgaccctc
tcgccccacgccgcgcatctgcgcgccggtcacaagatgggcgacgtcaaatatatcgac
acgatgatccgtgacggcctgtgggacgcgttcaacggctaccacatgggccagaccgcc
gaaaacgtcgccgaacagtggcagatcagccgcgagcagcaggatgaattcgctgttgct
tcgcagaacaaggccgaggccgcgcagaacgctgggaagttcgacgacgaggtgatcccc
ttcgtggtcaagcaccgcaagggcgacatcaccgtcgacaaggatgagtacatccgccac
ggcgccacgatcgaagccatgcagaaactgcgcccggccttcaccaaagacggctcggtc
accgcggccaacgcctcgggcatcaacgatggcgccgccggcgtgctgctgatgagcgcc
gagaacgccgagaagcgcggcatccagccgctggcgcgcatcgcctcttatgccaccgcc
gggctcgatccgtcgatcatgggcgtcggcccgatccacgcctcgcgcaaggcgctggag
aaggcaggctggaagcccgaggacctcgatctggtcgaggccaacgaagcctttgccgcg
caggcctgcgccgtgaacaaggacatgggctgggatccggcgatcgtgaacgtgaacggc
ggcgccatcgccatcggccacccgatcggcgcgtcgggcgcgcgcattctcaacacgctg
ctctttgaaatgcagcgccgcgacgccaagaagggcctcgcaacgctctgcatcggcggc
ggcatgggcgttgccctctgcgtcgagcgcgactga

DBGET integrated database retrieval system