KEGG   Yangia sp. CCB-MM3: AYJ57_17385Help
Entry
AYJ57_17385       CDS       T04443                                 

Definition
(GenBank) hypothetical protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
yan  Yangia sp. CCB-MM3
Pathway
yan00051  Fructose and mannose metabolism
yan01100  Metabolic pathways
yan01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:yan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    AYJ57_17385
Enzymes [BR:yan01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     AYJ57_17385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ANT62200
UniProt: A0A1B1PUI9
Position
2:complement(792937..793584)
Genome map
AA seq 215 aa AA seqDB search
MTETIRTALLEYSRASVARGLTGGTSGNISQRHGTGMMVTPSGIAPERMTSGQMVEMAFD
GTHDSPCAPTSEWALHAAIYQSRPEVGAIVHAHPRHCTALSALRRPIPAFHYLVGGLGGF
EVPCASYATFGTPEMAQAVITAIAPGFHGCLMANHGMVAFGRDLPQAFGRALLMETLAEQ
YLLALSSGLAPVLLSPEEMADVAAQAVRLNYGSQS
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaacgatccgcaccgccctgctagagtacagccgcgcatctgttgcacgaggg
ctcaccggcggcacatcagggaacatcagtcagcgccacggcaccggcatgatggtcacg
ccctcggggatcgcacccgagcggatgacctccgggcagatggtcgagatggccttcgat
ggcactcacgacagcccttgcgcgccaacatcggaatgggcgctgcatgcggcaatctat
caaagccggcccgaggtgggggcaatcgttcatgcccatccccgacattgcaccgcgctg
tccgctctgcgacgcccgatccccgccttccactacctcgtgggtggcttgggcggattc
gaggtgccctgtgctagttatgcgaccttcggcacacccgaaatggcacaggcggtgatc
acggcaatcgcacccgggttccacgggtgcctgatggccaatcatggcatggtcgcgttc
ggccgcgacctgccgcaggcctttggccgggccttactgatggaaacgctggctgagcag
tatcttttggcgctgtcatccggcctggcacccgtgctgctctcgccagaagaaatggcg
gacgttgccgctcaggcagtgcgtctcaactatggctcacaaagttga

DBGET integrated database retrieval system