KEGG   Yersinia enterocolitica (type O 5) YE53/03: YE5303_05971Help
Entry
YE5303_05971      CDS       T03739                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
yee  Yersinia enterocolitica (type O:5) YE53/03
Brite
KEGG Orthology (KO) [BR:yee00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:yee03009]
    YE5303_05971
Enzymes [BR:yee01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     YE5303_05971
Ribosome biogenesis [BR:yee03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    YE5303_05971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ Spt5-NGN
Motif
Other DBs
NCBI-ProteinID: CCQ39307
Position
1010478..1011584
Genome map
AA seq 368 aa AA seqDB search
MNNKIALYCRSGFEKECAAEITAKAAQLEIFGFARVKENSGYVLFECYQLEDADRLIREV
PFRELIFARQMMVVGELLKDLPPEDRVSPIVGMLTGVVEKAGELRVEVADTNESKELLKF
CRKLTVPLRNAMREQKILSARENPHRPVVHVFFIASGCCYVGYSYSNNNSPFYMGIPRLK
FPSDAPSRSTLKLEEAFHVFIPADEWEERLASGMHAVDLGACPGGWTYQLVQRSMMVQAI
DNGLMAQSLMDTGQVTHHRVDGFKYEPTRSNIYWLVCDMVEKPAKVTQLIIKWLVNGWCR
EAIFNLKLPMKKRFEVVSENLEMIDEQLKENGINAHIQAKQLYHDREEVTVHVRRIWSGV
PGRRDERF
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaataataaaattgctttatattgccgctcaggttttgagaaagagtgtgcggcggaa
attaccgccaaagcagcacagctcgaaatctttggtttcgctcgggtaaaagaaaatagc
ggttatgtgctgtttgaatgttatcagttggaagatgcggatcgtttgattcgtgaagtg
ccattccgcgaattgattttcgcccgccaaatgatggttgtgggtgagctactgaaagat
ttaccgccggaagatcgcgtatcgccaatagttggtatgttaaccggtgttgtcgagaaa
gccggtgaactgcgagttgaagttgctgacaccaatgaaagcaaagagttacttaagttt
tgccgtaagttgacggtgccgttgcgtaatgcaatgcgtgagcaaaaaattctgtctgcc
cgtgagaatcctcatcggccagtggtgcatgtattctttattgcatcgggttgttgttat
gttggttattcttatagcaacaataactccccgttctatatggggatcccgcgccttaag
ttcccatctgatgccccaagccgttcaactcttaaactggaagaagctttccatgtgttt
atccccgcagatgaatgggaagagcgtttagccagtggtatgcatgctgtcgatttagga
gcttgtcccggtggttggacttatcagttagtgcaacgcagcatgatggttcaggccatt
gataatggcttgatggcacaaagtttgatggataccgggcaggttacgcaccatcgcgta
gacggttttaaatatgagccaacacgtagcaatatttactggttagtgtgcgatatggtg
gaaaaaccggctaaagtcacccaacttattattaaatggctggtcaatggttggtgtcgt
gaggctatttttaacctgaagttaccgatgaaaaagcgttttgaagttgtttcagaaaat
ctggaaatgattgatgaacagctaaaagaaaatggtattaatgcccatattcaggctaag
cagctctatcatgaccgcgaagaagttacggtgcatgtgcggcgtatttggtctggtgtg
ccgggccgtcgtgatgagcgtttttaa

DBGET integrated database retrieval system