KEGG   Yersinia enterocolitica (type O 5) YE53/03: YE5303_11121Help
Entry
YE5303_11121      CDS       T03739                                 

Gene name
hisQ
Definition
(GenBank) histidine transport system permease protein HisQ
  KO
K10016  histidine transport system permease protein
Organism
yee  Yersinia enterocolitica (type O:5) YE53/03
Pathway
yee02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:yee00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    YE5303_11121 (hisQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:yee02000]
    YE5303_11121 (hisQ)
Transporters [BR:yee02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    YE5303_11121 (hisQ)
   Histidine transporter
    YE5303_11121 (hisQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: CCQ39818
Position
1577272..1577958
Genome map
AA seq 228 aa AA seqDB search
MLDGYSKLIFEGALVTLELALCSVLLSVIIGLIGAGGKLSSNRLLSGLFECYTTLIRGVP
DLVLMLLIFYGLQIVLNSITESLGFAQINIDPLSAGIITLGFIYGAYFTETFRGAYMAVP
NGQIEAARAFGFSSSQIFRRIMFPAMMRYALPGIGNNWQVILKATALVSILGLNDVVKAT
QLAGKGTYQPFFFALVAGVVYLIFTTLSNGILLWLERRYSHGVKRAEL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgctggatggatattccaaactgatatttgaaggtgcgctggtgacactggagctagca
ctgtgctcagtgctactgtcagtgattatcggcttaataggtgccggtgggaaattatcg
tcaaatcggctgttatctggcttatttgagtgctacaccacgttaatacgtggcgtccct
gatttagttttgatgttgcttatcttttatggtttgcagatagtcctaaatagcattact
gaatcccttggttttgcacaaatcaatattgatcctctttcagctgggattatcaccctt
ggttttatctatggtgcttacttcactgaaacattccgtggcgcttatatggcggttcca
aacggccagattgaagccgccagagcatttggtttctcttccagccagattttccgcaga
attatgtttcctgccatgatgcgttatgcgttgccaggcattggtaataattggcaagtt
attctcaaggcgacagctttagtctctattctgggattgaatgacgtcgttaaagcaact
cagttggctggaaaggggacttatcaaccattcttcttcgcattggtggctggcgtggtt
tatctcatttttaccaccctatccaatggtattttactgtggctggaacggcgctattcc
cacggagtgaagagggccgaactatga

DBGET integrated database retrieval system