KEGG   Yersinia enterocolitica (type O 5) YE53/03: YE5303_15151Help
Entry
YE5303_15151      CDS       T03739                                 

Definition
(GenBank) putative sucrose-6 phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
yee  Yersinia enterocolitica (type O:5) YE53/03
Pathway
yee00052  Galactose metabolism
yee00500  Starch and sucrose metabolism
yee01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yee00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    YE5303_15151
   00500 Starch and sucrose metabolism
    YE5303_15151
Enzymes [BR:yee01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     YE5303_15151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF4975
Motif
Other DBs
NCBI-ProteinID: CCQ40220
Position
2051504..2052973
Genome map
AA seq 489 aa AA seqDB search
MNPLIERANDALQTLASQVGQNFYPHYHLAPPAGWMNDPNGLIFFNGQYHAFYQHHPYDE
NWGPMHWGHATSHDMLSWQHQSIALAPGDLWDKDGCFSGCAVDDNGVLSLIYTGHVWLNG
EGDDSAIREVQCLATSQDGIHFDKQGVVLTPPEGIMHFRDPKVWFEDDCWWMVVGARDKR
DHGQVLLYRGNSLQQWQFMQVLARADDSMGYMWECPDFFPLGNERILMFSPQGLVAKGYL
NRNLFQSGVLRGKWQPGADFKPSQPFTELDLGHDFYAPQSLLTADGRRVIIGWMDMWQSP
MPTKADNWSGCLTLPRELSIDCDGNLLIKPVREVEALRQAGEFITSMTLAQEKQLLHENC
QSLELQLTWDTTASHAERYGVQLADAQGTGGKVSVYVDSQANRLVLDRYYPQYGLTGYRS
VVLPEQGVLSLRIFIDSSSLEVFINDGQACMSSRIYPTEHERCLSLYAENGQAQLLHGEY
WQLVAKSSR
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaatccattaattgaacgggccaatgatgcactgcaaactttagcttctcaggttggc
caaaatttctatccacattatcatttggctccgccggcagggtggatgaatgaccccaac
gggttgatcttttttaacggacagtatcacgcgttttatcagcatcacccttatgatgaa
aattgggggccgatgcattggggccatgcgaccagccacgatatgttgagttggcaacat
caatccattgccttagctccaggtgatttatgggataaagacggttgtttttctggttgt
gcggtagacgataatggcgtgttaagcctgatttataccggacatgtttggcttaacggt
gagggtgatgacagcgctattcgcgaggtgcagtgcctggcaaccagtcaggatggcata
cattttgacaaacaaggtgtggtactgaccccgcccgagggaatcatgcatttccgcgat
ccgaaagtgtggtttgaagatgattgttggtggatggtagtcggtgctcgagataagcga
gatcatgggcaagtcttgctatatcgcggcaattcattgcagcaatggcaatttatgcaa
gttttagcgcgcgcagacgacagcatgggatatatgtgggaatgtccagatttcttccca
ttagggaatgaacgtattctgatgttttcaccgcaggggctggtagcaaaaggttacctc
aatcgcaatttgttccaaagtggtgtcttacgcggcaaatggcagccaggagccgatttt
aagccttcgcagccttttaccgaactggatctgggccatgatttctatgcacctcaatcc
ctacttactgctgatgggcggcgagtcattattggttggatggatatgtggcaatcgcct
atgccgaccaaggccgataattggagtggctgcttaaccttgccacgagaattaagtatt
gattgtgatggtaatttattaataaaaccggtgcgggaggttgaagcactaaggcaagcc
ggtgaattcatcacatcaatgacactggcccaagagaaacaacttttacatgaaaattgc
cagagtctggaactgcaattgacatgggataccacagccagtcatgcagaaagatatggt
gtgcagttagctgatgcccaaggaacgggtggtaaagtttcggtttatgtcgatagtcag
gctaatcgactagttttggataggtattacccacaatatggactgacggggtatcgcagt
gtggtattaccagaacagggggtattatcattacgtatatttattgatagttcgtcgttg
gaggtatttatcaatgacgggcaagcttgtatgagcagtcgtatctacccgaccgagcat
gaacgctgtttatccctgtatgcggagaatggtcaggcccagctactacacggcgaatac
tggcagttagtggctaaatcatcacgttga

DBGET integrated database retrieval system