KEGG   Yersinia enterocolitica (type O 5) YE53/03: YE5303_20361Help
Entry
YE5303_20361      CDS       T03739                                 

Gene name
btuE
Definition
(GenBank) putative vitamin B12 transport protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
yee  Yersinia enterocolitica (type O:5) YE53/03
Pathway
yee00480  Glutathione metabolism
yee00590  Arachidonic acid metabolism
yee01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yee00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    YE5303_20361 (btuE)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    YE5303_20361 (btuE)
Enzymes [BR:yee01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     YE5303_20361 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA AHJR-like
Motif
Other DBs
NCBI-ProteinID: CCQ40739
Position
complement(2612311..2612865)
Genome map
AA seq 184 aa AA seqDB search
MSHSIYSIPVKTIESQSVNLEKYKGSVLLVVNVASQCGLTKQYEGLENLYKTYQQQGFEV
LGFPSNEFAGQEPGSDAEIQAFCRGTFGVDFPMFSKIEVNGPQRHPLYQHLIAAKPAAVK
PEGSEFYQRLASKGREPKQAGDILWNFEKFLIGRDGTVLERFAPDMTPEDPILVNAITRA
LAAH
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgagtcattcaatttattccatcccagtaaaaacgattgaaagccaatccgttaacctg
gaaaagtataaaggatcggttttgctggtggtcaatgtggcttcccaatgtggtttaacc
aagcagtatgaaggtttggagaatctatacaaaacatatcagcaacagggttttgaagta
ttgggctttccaagcaatgagtttgcggggcaggagcctggcagcgatgcggaaattcag
gcattttgtcgtggaacttttggtgtcgatttcccgatgttcagtaaaatagaagtcaat
ggcccacaacggcaccctttataccaacatctaatcgcggccaaacctgcggcagtaaaa
cctgaaggtagtgagttctatcagcgcttagcaagtaaaggtcgtgagccaaaacaggcc
ggcgacattctgtggaactttgaaaaattcttgattggccgagatggtacggttcttgaa
agatttgcacccgatatgacgccagaagacccgattttggtcaatgctattacacgcgca
ttggctgctcactaa

DBGET integrated database retrieval system