KEGG   Yersinia enterocolitica (type O 5) YE53/03: YE5303_27091Help
Entry
YE5303_27091      CDS       T03739                                 

Gene name
apaG
Definition
(GenBank) ApaG protein homologue
  KO
K06195  ApaG protein
Organism
yee  Yersinia enterocolitica (type O:5) YE53/03
Brite
KEGG Orthology (KO) [BR:yee00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    YE5303_27091 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: CCQ42021
Position
4065882..4066259
Genome map
AA seq 125 aa AA seqDB search
MIEQPRVCVQVQSIYVETQSIPDEERFVFAYTVTIRNLGRSNVQLMGRYWLITNSNGRQT
EVQGEGVIGEQPLILPGNEFQYTSGAVLETPLGTMEGHYEMVDHLGQAFRTVIPVFRLAI
PTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgattgaacagccccgcgtttgtgtacaggtgcaaagtatctatgtggaaacccagtcg
ataccagacgaggaacgtttcgtctttgcctataccgtgacgattcgtaatctgggccgt
tcaaatgtgcaacttatgggccgctattggttaattactaatagtaatggccggcagaca
gaagttcagggcgaaggagttatcggtgaacagccgttgatcctgccaggtaacgagttc
caatacaccagcggggctgtgctagaaacgccgctgggtaccatggaagggcattatgag
atggttgatcaccttggtcaggcgttccgtactgtgattccggtgttccgcttagcgatc
ccaacactaatccattaa

DBGET integrated database retrieval system