KEGG   Yersinia enterocolitica (type O 5) YE53/03: YE5303_36151Help
Entry
YE5303_36151      CDS       T03739                                 

Gene name
ispA
Definition
(GenBank) geranyltranstransferase
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
yee  Yersinia enterocolitica (type O:5) YE53/03
Pathway
yee00900  Terpenoid backbone biosynthesis
yee01100  Metabolic pathways
yee01110  Biosynthesis of secondary metabolites
yee01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:yee00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    YE5303_36151 (ispA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:yee01006]
    YE5303_36151 (ispA)
Enzymes [BR:yee01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     YE5303_36151 (ispA)
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     YE5303_36151 (ispA)
Prenyltransferases [BR:yee01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   YE5303_36151 (ispA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: CCQ41664
Position
3623127..3624047
Genome map
AA seq 306 aa AA seqDB search
MSNTPSSVDFNQQLAAHQQRVNQALLDFIAPLPFGNSDLVEAMRYGAVLGGKRLRPYLVY
ATGQMFGLPLTSLDAPAAAIECIHAYSLIHDDLPAMDDDDLRRGQPTCHVKFGEANAILA
GDALQTLAFSILAEAPMPDVADKDRLSMIAELAHASGVAGMCGGQALDLAAESRQITLDD
LEKIHRHKTGALIRAAVRLGALAAGAPGREALPLLDRYANAIGLAFQVQDDILDVIGDTA
TIGKRQGSDQQHGKSTYPALMGLDCAKAKATDLYQEALSALNALSAQSYNTAPLQALACF
IIERDN
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtctaacaccccctcctcagttgatttcaatcaacaacttgccgcacatcagcagcga
gtcaatcaggctctgttggatttcattgcgccgctcccttttggcaatagtgatctggta
gaggcaatgcgctatggcgctgtgctgggtggtaagcggctgcgcccttatctggtttac
gccactggccaaatgttcggtctgccactgaccagtctggatgccccagcggcggcaatt
gaatgtatccatgcttattcattaattcatgatgatttaccggcaatggatgatgatgat
ctacgccgtgggcaaccgacttgccatgtgaagtttggtgaagccaatgccattctggcc
ggtgatgccctgcaaacgctggcattttctatcctggcagaagcccccatgcccgatgtg
gctgataaagatcggctgtcgatgattgcagaattagcccatgccagcggtgttgccggt
atgtgcggcggccaggcattggatttggcagcagaatcccgtcagataacactggatgac
cttgagaagatccaccgtcataaaaccggagcactcattcgtgccgcagttcgtctcggt
gcgctggctgctggtgcccctgggcgtgaagccctccccttacttgaccgttatgccaat
gcaatcggtctggcctttcaagtgcaagacgatattttagacgttatcggcgatacagct
acaattggtaaacgccaaggttctgatcagcaacacgggaaaagcacttatccggccctt
atggggctagattgcgccaaagccaaagccaccgatctttatcaggaagcacttagcgcc
ctgaatgcgctgtcggcgcaatcctataacacagcgccactacaggcgttagcctgcttt
attattgagcgtgataattag

DBGET integrated database retrieval system