KEGG   Yersinia enterocolitica (type O 5) YE53/03: YE5303_38771Help
Entry
YE5303_38771      CDS       T03739                                 

Definition
(GenBank) methylaspartate ammonia-lyase
  KO
K04835  methylaspartate ammonia-lyase [EC:4.3.1.2]
Organism
yee  Yersinia enterocolitica (type O:5) YE53/03
Pathway
yee00630  Glyoxylate and dicarboxylate metabolism
yee00660  C5-Branched dibasic acid metabolism
yee01100  Metabolic pathways
yee01120  Microbial metabolism in diverse environments
yee01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:yee00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    YE5303_38771
   00660 C5-Branched dibasic acid metabolism
    YE5303_38771
Enzymes [BR:yee01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.2  methylaspartate ammonia-lyase
     YE5303_38771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MAAL_C MAAL_N MR_MLE_C Enolase_C
Motif
Other DBs
NCBI-ProteinID: CCQ42585
Position
4704785..4706029
Genome map
AA seq 414 aa AA seqDB search
MKIKHALFTAGNSSFYFDDQQAIKNGAKLDGFIYQGKPVTEGFSAIRQAGECVNVQLILE
NGAVAVGDCAAVQYSGAGGRDPLFIAANFVPFLEKHIKPLLEGRDISEFRLNATFFDEVT
IDGKPLHTAIRYGLSQALLDATALATGRLKAEVVCDEWHLPLVAKPIPLFGQSGDDRYIA
VDKMILKGVDVLPHGLINNVDEKLGRNGEKLREYVSWLAKRVSDLRVDPSYKPDLHIDVY
GTIGLIFDMDPMLCAEYIASLQEQAGELNLYIEGPVDAGNKPDQIRLLTEITHNLEKLGS
NVKIVADEWCNTYQDIIDFTDAGSCHMVQIKTPDLGSIHNIVDAVLYCNKKGMEAYQGGT
CNETDISARTCVHVAIASRPMRMLIKPGMGFDEGMNIVFNEMTRTIAQLKTKAN
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcaagcacgcactattcaccgcaggcaactcatctttctacttcgatgaccag
caggccatcaaaaatggtgcgaaattggatggatttatctatcaaggtaaacctgtaact
gagggatttagcgcaattcgtcaggcgggtgaatgcgttaacgtccaactaatcttagaa
aatggtgctgtcgctgtgggcgattgtgctgccgtacaatactcaggtgccggtggccgt
gatcctttgtttatcgctgcaaattttgttcctttcctggaaaaacacatcaaacctctg
ctggaagggcgcgatatcagtgaatttcgtctgaacgcaaccttctttgatgaagtgact
attgatggcaaaccgctgcatacggccatccgttatggtctttctcaggcattactggat
gcaaccgcattagcgactggccgtttaaaagcagaagtggtgtgcgatgaatggcatctg
ccattagttgccaaaccgatccctctgtttggtcaaagcggtgacgaccgttatatcgcc
gtcgataaaatgattcttaaaggtgtggatgttctgccacatggccttatcaataatgtt
gatgaaaaactggggcgtaatggcgagaaactgcgtgaatatgtgagctggttggctaaa
cgcgtcagtgatttacgcgtcgatccgagctacaaaccggatttacatatcgacgtttac
ggcactattggcctgattttcgacatggatccgatgctatgcgcagagtacatcgccagc
ttgcaggaacaggccggtgaactgaatttatatatcgaagggccggttgatgcgggcaat
aaaccagaccaaatccgtctgttaaccgaaatcacccacaacctggaaaaactgggttcg
aacgtcaaaatcgtggccgacgaatggtgtaacacctaccaagacatcatcgattttact
gatgcaggtagctgtcacatggtgcagatcaaaaccccagacttgggcagtattcacaac
attgttgatgctgttctgtattgcaataaaaaaggtatggaagcgtatcaaggcggtact
tgtaacgaaaccgatatcagcgctcgcacctgcgtacatgttgctatcgcctcccggcca
atgcgtatgctcatcaaaccgggtatgggttttgatgaagggatgaacattgtgttcaac
gagatgactcgcaccatcgcgcaactgaagacaaaggctaactga

DBGET integrated database retrieval system