KEGG   Yersinia enterocolitica FORC_002: FORC2_0028Help
Entry
FORC2_0028        CDS       T03890                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
yef  Yersinia enterocolitica FORC_002
Pathway
yef00051  Fructose and mannose metabolism
yef01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yef00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    FORC2_0028
Enzymes [BR:yef01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     FORC2_0028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh ApbA 3HCDH_N SpoU_sub_bind UDPG_MGDP_dh_N Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AKF36175
Position
35419..36579
Genome map
AA seq 386 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAGAQLTFADVNQPLLDELNKRKSYQVNVVGEQARVEEV
KNVSAVNSGSPEVVELIAQADIVTTAVGPQILARIAGTVAQGLVARHQQGNTRPLNIIAC
ENMVRGTSQLKQHVFAALPESEQAWVEQHVGFVDSAVDRIVPPSEAGSTDILAVTVETFS
EWIVDGTQFKGQPPQIAGMELTDNLMAFVERKLFTLNTGHAITAYLGQLAGHQTIRDAIL
DPAVRQTVKGAMEESGAVLIKRYAFDPQKHAAYIEKILSRFENPYLHDDVERVGRQPLRK
LSAGDRLIKPLLGTLEYQLPHNNLVTGIAAAMSYRSEQDPQAQELVELLAKLGPKATLAQ
ISGLPADSEVVEQAVSVYNAMQDKLA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggcgcaggtaatattggccggggcttcattggtaaactgctg
gctgatgccggagcacagcttactttcgccgatgttaatcagccgctattggatgagctg
aataagcgtaagagttatcaggttaatgtggtgggtgagcaagcacgagtcgaagaagtg
aagaatgttagcgccgtcaacagtggtagcccggaagtggtggaactgattgcacaagca
gatattgtcaccaccgcggttggcccacaaattctggcccgcatcgcaggcacagtggca
caaggtttggttgcccgccatcaacaaggtaatacccgcccactgaatattattgcttgt
gagaatatggtgcgtggcaccagccagttgaaacagcatgtttttgctgccttgccagaa
agtgagcaggcatgggttgagcaacatgttggatttgttgattctgcggtagaccgcatt
gtgccaccatcagaagcaggcagtactgatattctggctgtgacagtagaaacattcagc
gagtggattgttgatggcacccagtttaaagggcagccaccgcaaatcgcgggtatggaa
ttgactgacaatctgatggcttttgtggagcgtaaactcttcactttgaacaccgggcac
gctattaccgcttatttgggccagcttgccggtcaccaaaccattcgtgatgccatcctt
gatcccgcggtacgccagacagtgaaaggtgcgatggaagagagtggtgcggtgctgatt
aagcgctatgcgtttgatccacagaaacacgccgcttatatcgaaaaaattctctcccgt
tttgaaaacccttatctgcacgatgatgttgagcgtgttggccgtcagccactgcgtaaa
ctgagtgccggtgaccgtttgatcaaaccgctgttggggactttggaatatcagttgcca
cataataacctggtgaccggtattgcggctgcgatgagctaccgcagtgagcaagaccca
caagcacaagaactggttgaattactggctaagttagggccgaaagccacgcttgctcaa
atttccggactaccagctgatagcgaggttgtggaacaggcggtgagtgtgtataacgcc
atgcaggacaagctggcataa

DBGET integrated database retrieval system