KEGG   Yersinia enterocolitica FORC_002: FORC2_0275Help
Entry
FORC2_0275        CDS       T03890                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
yef  Yersinia enterocolitica FORC_002
Pathway
yef03010  Ribosome
Brite
KEGG Orthology (KO) [BR:yef00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    FORC2_0275
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:yef03011]
    FORC2_0275
Ribosome [BR:yef03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    FORC2_0275
  Bacteria
    FORC2_0275
  Archaea
    FORC2_0275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AKF36422
UniProt: A0A0E1NHA4
Position
334899..335231
Genome map
AA seq 110 aa AA seqDB search
METIAKHRHARSSAQKVRLVADLIRGKKVSQALETLAYTNKKAAGLVKKVLESAIANAEH
NDGADIDDLKVTKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSDR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaactatcgctaaacatcgccacgctcgttcttctgctcagaaggttcgcttggta
gcggacctgattcgcggtaagaaagtgtcgcaagctctggaaactctggcctataccaac
aagaaagctgctggtttggttaagaaggtactagagtctgccattgctaacgcagaacac
aacgatggcgctgacatcgatgatctgaaagtcacgaagattttcgtagacgaaggccct
agcatgaagcgcattatgccgcgtgcaaaaggtcgtgcagatcgcatcctgaagcgcacc
agccacattactgtggttgtgtccgatcgctga

DBGET integrated database retrieval system