KEGG   Yersinia enterocolitica FORC_002: FORC2_3539Help
Entry
FORC2_3539        CDS       T03890                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
yef  Yersinia enterocolitica FORC_002
Pathway
yef00052  Galactose metabolism
yef00500  Starch and sucrose metabolism
yef01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yef00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    FORC2_3539
   00500 Starch and sucrose metabolism
    FORC2_3539
Enzymes [BR:yef01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     FORC2_3539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AKF39686
Position
4024619..4026028
Genome map
AA seq 469 aa AA seqDB search
MQEASLLKHLTLAVMRGQGRALQDPHRPGWHLAPCVGLLNDPNGFIYHAGYYHLFYQWNP
LDCRHGSKYWGHWRSTDLVHWEHQPVALVPSEAYESHGCYSGSAVIADNIITLIYTGNVK
YPDGSRTAFQCLAQENERGEFDKLGPVLPLPAGYTGHVRDPKVWQHDGQWYMVLGAQDKQ
LQGKVLLLRSGDLREWHNLGEIAGSGLGGLGPFGYMWECPDLFTLADKDVLMFCPQGIPA
EAERYRNTFQVGYLLGKLDYTNATFNHQAFHELDAGFEFYAPQTTLAADGRRLLFGWMGL
PDEDEFYQPTVEYGWIHTMTCPRELSLNGDKLIQQPARELAALRCEHTQWQGRAQEAPAL
AIGSAEMIIDVSAPFTLELGNTLLLEWDGARLILSRNNLRTGLREFRYWRGQLQQLQLLC
DRCSIEIFINQGEAVMTSSYFPPVPPQAIFAGSAELRVQHWLLSSPMLE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaagccagtttgcttaaacatcttacgctggcagtaatgcgcggtcagggccgc
gcattacaagacccacaccggccgggctggcacttagctccctgtgtcgggttgctgaat
gatcctaatgggtttatttatcatgctggctattatcatctgttttatcaatggaatccg
ctggattgccgccacggcagtaaatattggggccactggcgcagcactgacttagtgcat
tgggagcatcaacccgtggcgttggtgccgagcgaagcctatgaaagtcatggttgttac
tccggttcggcggtaattgctgataacattatcaccctgatttacaccggaaatgtgaaa
taccccgatggctcccgtaccgcattccaatgtttggcacaggaaaatgaacggggcgag
ttcgacaagttagggccagtgctcccattgcccgctggctataccggacatgtgcgtgac
ccgaaagtctggcagcacgacggccagtggtacatggtgttaggcgctcaggacaaacaa
ctacaaggcaaggtgctactgctgcgctctggtgatttacgcgaatggcataatctgggt
gagatagctggctctggtctgggggggcttgggccttttggctatatgtgggaatgcccc
gacctgtttaccctggcagataaagacgttttgatgttctgcccacagggtataccagcc
gaagctgaacgctatcgtaatacctttcaggtaggctatttactgggcaaattagattat
accaacgccaccttcaatcaccaggcattccacgagttggacgctggctttgagttttac
gcgccgcaaaccacgctggccgcagatggccgtcgcttattattcggctggatgggtctt
ccagatgaagatgagttttaccaaccgacagtggaatatggctggatccacaccatgact
tgcccgcgcgagttgagtcttaatggcgacaaactgattcagcaaccggcccgcgagtta
gccgcgctgcggtgtgaacatacgcagtggcaaggccgtgcccaagaagcccctgctctt
gcaatcggtagtgccgaaatgataatcgacgtcagtgcgcctttcaccctcgaattgggc
aatactctgctgttggaatgggatggtgcgcgcttgattttaagtcgtaataatctgcgc
accggattgcgagaattccgttactggcgcggtcaattgcaacaattacagttactttgc
gatcgttgcagcatagagatttttatcaatcagggggaagcggtgatgacgtcgagttac
ttcccaccagtaccgccacaagccatttttgcgggaagtgctgaactgcgagtgcaacac
tggctgttgtcttcgcccatgttagaatga

DBGET integrated database retrieval system