KEGG   Yersinia enterocolitica LC20: LC20_01684Help
Entry
LC20_01684        CDS       T03179                                 

Definition
(GenBank) ADP-forming succinate--CoA ligase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
yel  Yersinia enterocolitica LC20
Pathway
yel00020  Citrate cycle (TCA cycle)
yel00640  Propanoate metabolism
yel00660  C5-Branched dibasic acid metabolism
yel01100  Metabolic pathways
yel01110  Biosynthesis of secondary metabolites
yel01120  Microbial metabolism in diverse environments
yel01130  Biosynthesis of antibiotics
yel01200  Carbon metabolism
Module
yel_M00009  Citrate cycle (TCA cycle, Krebs cycle)
yel_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:yel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LC20_01684
   00640 Propanoate metabolism
    LC20_01684
   00660 C5-Branched dibasic acid metabolism
    LC20_01684
Enzymes [BR:yel01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     LC20_01684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: AHM72937
Position
1493283..1494449
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGMPAPTGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV
KLVNSKEDIRAFAEQWLGKKLVTYQTDVHGQPVHQILVEAATDIDKELYLGAVIDRSSRR
VVFMASTEGGVEIEKVAEETPELIHKTALDPLTGPQPYQGRELAFKLGLTGKQVAQFTKI
FMGLATMFLERDLAMVEINPLVITKQGDLVCLDGKLGADGNALFRQSELREMRDPSQEDA
REAHAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGDPANFLDVGGGATKERVTE
AFKIILSDDKVKAVFVNIFGGIVRCDLIADGIIGAVEEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAATSLTDAAQQVVAAVGAK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacacgaatatcaggcaaaacaactgtttgctcggtatggcatgccagcacca
actggctacgcttgtactacaccgcgtgaagcagaagaagccgcatctaaaatcggtgct
ggcccgtgggtggttaaatgtcaggtacatgctggtggccgcggtaaagcgggcggtgtg
aaactggtcaacagcaaagaagatattcgtgctttcgctgaacagtggttaggtaaaaaa
ctagttacttatcaaactgatgtccatggtcagccggttcaccaaattttggttgaagct
gcgactgatatcgacaaagagctgtatttgggggcggttattgaccgtagctcccgtcgt
gtggtgtttatggcctccaccgagggcggcgttgaaattgaaaaagttgctgaagaaaca
ccagaactgatccacaaaaccgcattggatccgttgactggcccgcagccttatcaaggc
cgtgagttggcattcaaattgggtctgaccggcaagcaagttgctcagttcaccaagatc
tttatgggtctggcaaccatgttcttggaacgtgatttggccatggttgagataaacccg
ctggttattaccaagcagggcgatttggtttgtttggatggcaagctgggtgctgatggt
aacgccttgttccgccagtctgaactgcgtgaaatgcgcgacccaagccaggaagatgcg
cgcgaagcccatgctgcacagtgggaactgaactacgttgcgctggatggcaacattggc
tgtatggtcaacggtgctggtttggcgatggggacgatggacatcgtgaaactgcacggt
ggcgatccggctaacttcttggatgttggcggtggtgccaccaaagagcgcgtgactgaa
gcctttaaaatcattttgtctgatgacaaagtgaaagcggtgtttgttaacattttcggc
ggcatagtgcgttgtgacctgattgctgacggcatcattggtgcggttgaagaagtgggt
gtcaacgtgccggtggtggttcgtctggaagggaataatgccgaactgggtgccaaaaaa
ctggcagacagcggtttgaatatcattgctgcgaccagcctgacagatgcggctcagcaa
gttgtagcggcagtgggggctaaataa

DBGET integrated database retrieval system